(data stored in ACNUC7421 zone)

EMBL: CP001658.PE710

CP001658.PE710       Location/Qualifiers
FT   CDS_pept        782718..783188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00696"
FT                   /product="30S ribosomal protein S7 rpsG"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00696"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23731"
FT                   /protein_id="ACT23731.1"
FT                   /translation="MPRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLKGKKSLAERIVYG
FT                   ALEQARDKTGTDPVITLKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWL
FT                   VGYSRQRREKTMIERLANEILDASNGLGASVKRREDTHKMAEANRAFAHYRW"
     atgccacgca aggggcccgc gcccaagcgt ccgttggtca acgacccggt ctacggatcg        60
     cagttggtca cccagttggt gaacaaggtt ctgttgaagg ggaaaaaatc gctggccgag       120
     cgcattgttt atggtgcgct tgagcaagct cgcgacaaga ccggcaccga tccggtgatc       180
     accctcaagc gggctctcga caatgtcaaa cccgccctgg aggtgcgcag ccgtcgcgtc       240
     ggcggcgcga cctatcaggt gcctgtcgag gtgcgccccg accggtcgac cacgctggcg       300
     ctgcgctggc tcgtcggcta ctcgcggcaa cgccgtgaga agacgatgat cgagcgcctg       360
     gcaaatgaga tcctggatgc cagcaatggc cttggggcct ccgtcaagcg gcgtgaggac       420
     acccacaaga tggccgaggc gaaccgagcc tttgcgcatt atcgctggtg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page