(data stored in ACNUC7421 zone)

EMBL: CP001658.PE713

CP001658.PE713       Location/Qualifiers
FT   CDS_pept        786933..787730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00699"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00699"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23734"
FT                   /protein_id="ACT23734.1"
FT                   /translation="MLARYIKMQLLVLLCGGLVGPIFLVVYFTLGLGSLMSWMFYVGLI
FT                   ITVADVLVALALTNYGAKTAAKTAALERSGVLALAQITGLSETGTRINDQPLVKVHLHI
FT                   SGPGITPFDTEDRVIASVTRLGNLTARKLVVLVNPATQQYLIDWERSALVNGLVPAQFT
FT                   VAEDNKTYDLSGQTGPLMEILQILKANNVPLNRMVDIRSNPALRQQVQAVVRRAAERQA
FT                   PAAEPASQGSIAERLAELESLRASGAVNAAEYESKRAQIISEI"
     gtgttagcgc gctacatcaa gatgcagtta ttggtgctgt tgtgcggtgg tctggtcggg        60
     ccgatcttct tggtcgtcta cttcacgctc ggactgggca gcctgatgtc gtggatgttc       120
     tatgtcggtc tgatcattac cgttgctgac gtgctggtcg cgctcgcatt gaccaactac       180
     ggggcaaaga ccgctgccaa gaccgcggca cttgaacgga gtggagtgct ggcgctcgcc       240
     caaatcaccg ggctcagcga gacagggacc cggatcaacg atcaaccgct ggtaaaggtg       300
     cacctgcaca tctcgggacc cggcatcact ccgttcgaca cggaagaccg ggtcatcgcc       360
     agtgtgaccc ggctgggcaa tctcacggct cgaaaactgg tggtattggt gaatcccgcc       420
     acgcagcaat acctgatcga ctgggaacga agcgctttgg tcaacggcct ggtgcccgcc       480
     caattcaccg tcgccgaaga caacaagacc tacgacttga gtgggcaaac cggcccgctg       540
     atggagatct tgcagattct gaaggcaaac aacgttccgc tgaaccggat ggttgacatc       600
     cgctcgaatc cggcactgcg tcagcaagtc caagcggtgg tgcggcgggc agccgagcgg       660
     caggcgccgg cggccgagcc agcgtcgcaa ggatcgatcg ccgagcggct tgcggagctg       720
     gaatcgctgc gcgccagcgg tgcggtcaac gcggcggaat acgagagcaa gcgcgcccag       780
     atcatctccg aaatctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page