(data stored in ACNUC7421 zone)

EMBL: CP001658.PE716

CP001658.PE716       Location/Qualifiers
FT   CDS_pept        complement(789941..790195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00702"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23737"
FT                   /protein_id="ACT23737.1"
FT                   /translation="MLGWTVKPGRVADGWQAPGVHLMARCSGPQPASERRADMDGGDID
FT                   AAVARVRAAGALAEPSRQPDDMSAECADDQGARCHLGQL"
     gtgctggggt ggaccgtcaa accgggccgc gtcgcggatg gctggcaggc gccgggcgtg        60
     catctgatgg cccggtgcag cgggccgcag cccgcatccg agcgccgtgc cgatatggac       120
     ggtggcgata tcgacgcggc ggtcgcacgg gtgcgtgcgg ccggcgcgct ggccgagccg       180
     tcccgacagc cagacgatat gtccgccgaa tgcgccgacg accagggcgc ccgctgccac       240
     ctaggtcagc tctag                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page