(data stored in ACNUC7421 zone)

EMBL: CP001658.PE717

CP001658.PE717       Location/Qualifiers
FT   CDS_pept        complement(790808..791857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00703"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00703"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23738"
FT                   /protein_id="ACT23738.1"
FT                   /translation="MTGTEHLVHTLRSQGRVCTSSGSPMYRELLELVAADVESGGVFAS
FT                   ILADQKGAPEGQAVPLRLLGGLHRMVLDGRAPVLRRWYPSTGGTWQAEAAWPDIVRTAT
FT                   DQPESLRAALDRPPQTNEVGRSAALIGGLLIACLQFDLPIRLFEIGSSAGLNLRPDRYR
FT                   YRYLGGEWGLADSPVRIDNAWLGELPPTATVRIVERHGYDIAPIDVTSPDGELNALSYI
FT                   WPDQTDRLERLRGAIAVARNIPADLHRQAAHAAVAGMTLTDDALTVLWHSITWQYLPAD
FT                   ERAAIRAGIDALAAQADAHCPFVHLTLEPAHQRPGAQIKYLVRMRSWPGGHARVLGECH
FT                   PHGPPVTWQ"
     gtgacgggca ccgaacacct ggtccacacc ctgcggtcac aggggcgggt gtgcacctcc        60
     tccggctccc cgatgtaccg cgagctactt gagctcgtgg cagctgacgt cgaaagcggc       120
     ggcgtcttcg cgtccatctt ggccgaccag aagggtgctc cggagggcca ggcggtgccg       180
     cttcggctgc tcggcggatt gcaccggatg gtgctcgacg gccgcgcacc ggtgttgcgc       240
     cgctggtacc ccagcaccgg cggcacctgg caggcggagg cagcctggcc cgatatcgtc       300
     cgcaccgcga ccgaccagcc ggagtcgctg cgtgcggctc tcgatcggcc accgcagacc       360
     aacgaggtag ggcgctcggc ggcgttgatc ggtggacttc tcatcgcctg cctccaattc       420
     gacttgccaa taaggctttt cgagataggg tccagtgcag ggctgaacct gcgaccagat       480
     cggtaccgct accgttatct cggcggcgaa tggggcctgg ccgactcacc ggtgcgaatc       540
     gacaatgcct ggctgggcga attgccgccg acggccacgg tgcggatcgt cgaacgacac       600
     ggatacgaca tcgcgcccat cgacgtcacc agccccgacg gggagctgaa cgcgttgagc       660
     tacatctggc cggaccagac cgatcggttg gagcggttgc ggggcgccat cgccgtcgcc       720
     cgcaacattc ccgcggacct ccatcggcag gcggcgcacg ccgcagtcgc cggcatgact       780
     ctgaccgacg atgcactcac cgtgttgtgg cattcgatca cctggcagta cctgcccgcc       840
     gacgaacgcg cagcgatccg cgccggaatc gacgcattag ccgcgcaagc cgatgcccac       900
     tgcccgttcg tgcacctcac cttggagcct gcccaccagc ggcccggcgc ccaaatcaag       960
     tacctggtac gtatgcgcag ttggccgggt ggtcacgccc gggtcttggg tgaatgccat      1020
     ccacacggcc caccggtgac ctggcaatga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page