(data stored in ACNUC7421 zone)

EMBL: CP001658.PE728

CP001658.PE728       Location/Qualifiers
FT   CDS_pept        801271..801576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00713"
FT                   /product="30S ribosomal protein S10 rpsJ"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00713"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23749"
FT                   /protein_id="ACT23749.1"
FT                   /translation="MAGQKIRIRLKAYDHEAIDASARKIVETVVRTGASVVGPVPLPTE
FT                   KNVYCVIRSPHKYKDSREHFEMRTHKRLIDIIDPTPKTVDALMRIDLPASVDVNIQ"
     gtggcgggac agaagatccg catcaggctg aaggcctacg accatgaggc cattgacgct        60
     tcggcgcgca agatcgtcga aaccgtcgtc cgcaccggtg ccagcgtcgt agggccggtg       120
     ccgctaccga ctgagaagaa cgtgtattgc gtcatccgct caccgcataa gtacaaggac       180
     tcgcgggagc acttcgagat gcgcacacac aagcggttga tcgacatcat cgatcccacg       240
     ccgaagaccg ttgacgcgct catgcgcatc gaccttccgg ccagcgtcga cgtcaacatc       300
     cagtag                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page