(data stored in ACNUC7421 zone)

EMBL: CP001658.PE730

CP001658.PE730       Location/Qualifiers
FT   CDS_pept        802246..802917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00715"
FT                   /product="50S ribosomal protein L4 rplD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00715"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23751"
FT                   /protein_id="ACT23751.1"
FT                   /translation="MAAQEQKTLKIDVKTPAGKVDGAIELPAELFDVPANIALMHQVVT
FT                   AQRAAARQGTHSTKTRGEVSGGGRKPYRQKGTGRARQGSTRAPQFTGGGVVHGPKPRDY
FT                   SQRTPKKMIAAALRGALSDRARNGRIHAITELVEGQNPSTKSARAFLASLTERKQVLVV
FT                   IGRSDEAGAKSVRNLPGVHILAPDQLNTYDVLRADDVVFSVEALNAYIAANTTTSEEVS
FT                   A"
     atggctgcgc aagagcagaa gacactcaaa atcgacgtca agacgccggc gggcaaggtc        60
     gacggcgcta tcgagctgcc ggccgagctg ttcgacgtcc cggccaacat cgcgctgatg       120
     caccaggtgg tcaccgccca gcgggcggcg gcacgccagg gtacccactc gacgaagacg       180
     cgcggcgagg tcagtggcgg tggccgcaag ccctaccggc agaaggggac cggtcgtgcc       240
     cggcagggct cgacgcgggc gccgcagttc accggcggtg gcgtggtaca cggtcccaag       300
     ccgcgcgact acagccagcg cacacccaag aagatgatcg ccgcggcgct gcgcggggcg       360
     ctgtccgacc gggcccgcaa cgggcgtatc cacgcgatca ccgagctagt ggaaggtcaa       420
     aacccgtcga ccaagagcgc cagggcattt ctggccagcc tgacagaacg taaacaggtg       480
     ctggtggtca tcgggcgcag cgacgaggcc ggcgcgaaaa gcgtgcgcaa tctgccgggc       540
     gtgcacatcc tggcgccgga ccagctcaac acctatgacg tgctgcgtgc cgacgacgtg       600
     gtgttcagcg ttgaggcgct gaatgcctat atcgcggcca acaccacgac gtccgaggag       660
     gtttcggcct ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page