(data stored in ACNUC7421 zone)

EMBL: CP001658.PE733

CP001658.PE733       Location/Qualifiers
FT   CDS_pept        804411..804692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00719"
FT                   /product="30S ribosomal protein S19 rpsS"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00719"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23754"
FT                   /protein_id="ACT23754.1"
FT                   /translation="MPRSLKKGPFVDEHLLKKVDVQNEKNTKQVIKTWSRRSTIIPDFI
FT                   GHTFAVHDGRKHVPVFVTESMVGHKLGEFAPTRTFKGHIKDDRKSKRR"
     atgccacgca gcctgaagaa gggcccgttc gtcgacgagc atctgctcaa gaaggtcgat        60
     gtccagaacg agaagaacac caagcaggtc atcaagacct ggtcgcgtcg gtcgaccatc       120
     attccggact tcatcggcca tacctttgcg gtgcacgacg gccgcaagca cgtccccgtg       180
     ttcgtcaccg aatcgatggt gggccacaaa cttggtgagt tcgcgccgac acgcaccttc       240
     aagggccaca ttaaagacga ccgaaagagc aagcggcgat ga                          282
//

If you have problems or comments...

PBIL Back to PBIL home page