(data stored in ACNUC7421 zone)

EMBL: CP001658.PE735

CP001658.PE735       Location/Qualifiers
FT   CDS_pept        805282..806106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00721"
FT                   /product="30S ribosomal protein S3 rpsC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00721"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23756"
FT                   /protein_id="ACT23756.1"
FT                   /translation="MGQKINPHGFRLGITTDWKSRWYADKQYAEYVKEDVAIRRLLSSG
FT                   LERAGIADVEIERTRDRVRVDIHTARPGIVIGRRGTEADRIRADLEKLTGKQVQLNILE
FT                   VKNPESQAQLVAQGVAEQLSNRVAFRRAMRKAIQSAMRQPNVKGIRVQCSGRLGGAEMS
FT                   RSEFYREGRVPLHTLRADIDYGLYEAKTTFGRIGVKVWIYKGDIVGGKRELAAAAPAGA
FT                   DRPRRERPSGTRPRRSGASGTTATGTDAGRAAGGEEAAPDAAAPVEAQSTES"
     gtgggccaaa agatcaatcc gcatggcttc cggctgggca tcaccaccga ctggaagtcg        60
     cgctggtatg ccgacaagca gtatgccgag tacgtcaagg aggacgtggc gatccgccgg       120
     ctgctgtcca gtggcctaga gcgtgctggg atcgccgatg tagagatcga gcggacccgc       180
     gaccgggtcc gggtggacat tcacaccgcg cgtccgggca tcgtcattgg tcggcgtggg       240
     accgaggccg accggattcg tgccgacctg gaaaagctga ccggcaagca ggtccagctc       300
     aacatcctgg aggtcaaaaa cccggagtcg caagcgcaat tagtggccca gggggtagcc       360
     gagcagttga gcaaccgggt ggcgttccgc cgcgcaatgc gcaaggcgat ccagtcggcg       420
     atgcgtcagc ccaacgtcaa gggaatccgg gtgcagtgct cgggccgcct cggcggcgcg       480
     gaaatgagcc gctcggagtt ctaccgcgag ggccgcgtcc cgctgcacac cttgcgggca       540
     gatatcgact acggcctata cgaggccaag accaccttcg gccggatcgg tgtgaaggtg       600
     tggatctaca agggtgacat cgtgggcggc aaacgtgaat tggctgccgc cgcgccagcg       660
     ggcgccgacc gtccgcgccg tgagcggccg tcgggcacgc gcccccgtcg cagcggtgct       720
     tcgggcacca cggcgaccgg taccgacgcg ggtcgggccg cgggtggcga agaggccgcg       780
     cctgacgccg cagcgcccgt tgaagcgcag agcacggaga gctga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page