(data stored in ACNUC7421 zone)

EMBL: CP001658.PE736

CP001658.PE736       Location/Qualifiers
FT   CDS_pept        806110..806526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00722"
FT                   /product="50S ribosomal protein L16 rplP"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00722"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23757"
FT                   /protein_id="ACT23757.1"
FT                   /translation="MLIPRKVKHRKQHHPRQRGIASGGTTVNFGDYGIQALEHAYVTNR
FT                   QIESARIAINRHIKRGGKVWINIFPDRPLTKKPAETRMGSGKGSPEWWVANVKPGRVLF
FT                   ELSYPNEGVARAALTRAIHKLPIKARIITREEQF"
     atgttgattc cccgtaaggt taaacatcgc aagcagcacc atcctcgcca gcgcggcatc        60
     gccagcggcg gcaccacggt gaacttcggc gactacggca ttcaggccct tgagcacgcc       120
     tatgtcacca accggcagat cgaatcggcg cgtatcgcca tcaaccggca catcaagcgt       180
     ggcggcaagg tttggatcaa catcttccct gaccgcccgc tgaccaagaa gcccgccgaa       240
     acccgcatgg gttcgggcaa gggctcgccg gagtggtggg tagccaacgt taagccgggc       300
     cgggtgctgt tcgagctcag ttaccccaat gaaggtgtcg cccgggccgc gctcacccga       360
     gcgatccaca agctgccgat caaggcacgc attattactc gagaggagca gttctga          417
//

If you have problems or comments...

PBIL Back to PBIL home page