(data stored in ACNUC7421 zone)

EMBL: CP001658.PE737

CP001658.PE737       Location/Qualifiers
FT   CDS_pept        806526..806759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00723"
FT                   /product="50S ribosomal protein L29 rpmC"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00723"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23758"
FT                   /protein_id="ACT23758.1"
FT                   /translation="MAVGVSPGELRELTDEELAERLRESKEELFNLRFQMATGQLNNNR
FT                   RLRTVRQEIARIYTVLRERELGLATGPDGKES"
     atggcagtgg gtgtctcgcc gggcgaactg cgtgagctca ccgacgagga gctggccgag        60
     cggttgcgcg agtccaagga agagttgttc aacttgcgtt tccagatggc gaccggccag       120
     ctcaacaata accgccggct ccgtacggtg cgtcaggaaa tcgcgcgcat ctacaccgtg       180
     ctgcgcgaac gagaactggg tctggcgact gggcccgatg gtaaggaatc gtga             234
//

If you have problems or comments...

PBIL Back to PBIL home page