(data stored in ACNUC7421 zone)

EMBL: CP001658.PE740

CP001658.PE740       Location/Qualifiers
FT   CDS_pept        809746..810645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00726"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00726"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23761"
FT                   /protein_id="ACT23761.1"
FT                   /translation="MLTELVDLPGGSFRMGSTRFYPEEAPIHTVTVRAFAVERHPVTNA
FT                   QFAEFVSATGYVTVAEQPLDPGLYPGVDAADLCPGAMVFCPTAGPVDLRDWRQWWDWVP
FT                   GACWRHPFGRDSDIADRAGHPVVQVAYPDAVAYARWAGRRLPTEAEWEYAARGGTTATY
FT                   AWGDQEKPGGMLMANTWQGRFPYRNDGALGWVGTSPVGRFPANGFGLLDMIGNVWEWTT
FT                   TEFYPHHRIDPPSTACCAPVKLATAADPTISQTLKGGSHLCAPEYCHRYRPAARSPQSQ
FT                   DTATTHIGFRCVADPVSG"
     gtgctgaccg agttggttga cctgcccggc ggatcgttcc gcatgggctc gacgcgcttc        60
     taccccgaag aagcgccgat tcataccgtg accgtgcgcg cctttgcggt agagcgacac       120
     ccggtgacca acgcgcaatt tgccgaattc gtctccgcga caggctatgt gacggttgca       180
     gaacaacccc ttgaccccgg gctctaccca ggagtggacg cagcagacct gtgtcccggt       240
     gcgatggtgt tttgtccgac ggccgggccg gtcgacctgc gtgactggcg gcaatggtgg       300
     gactgggtac ctggcgcctg ctggcgccat ccgtttggcc gggacagcga tatcgccgac       360
     cgagccggcc acccggtcgt acaggtggcc tatccggacg ccgtggccta cgcacgatgg       420
     gctggtcgac gcctaccgac cgaggccgag tgggagtacg cggcccgtgg cggaaccacg       480
     gcaacctatg cgtggggcga ccaggagaag ccggggggca tgctcatggc gaacacctgg       540
     cagggccggt ttccttaccg caacgacggt gcattgggct gggtgggaac ctccccggtg       600
     ggcaggtttc cggccaacgg gtttggcttg ctcgacatga tcggaaacgt ttgggagtgg       660
     accaccaccg agttctatcc acaccatcgc atcgatccac cctcgacggc ctgctgcgca       720
     ccggtcaagc tcgctacagc cgccgacccg acgatcagcc agaccctcaa gggcggctcg       780
     cacctgtgcg cgccggagta ctgccaccgc taccgcccgg cggcgcgctc gccgcagtcg       840
     caggacaccg cgaccaccca tatcgggttc cggtgcgtgg ccgacccggt gtccgggtag       900
//

If you have problems or comments...

PBIL Back to PBIL home page