(data stored in ACNUC7421 zone)

EMBL: CP001658.PE741

CP001658.PE741       Location/Qualifiers
FT   CDS_pept        810946..811887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00727"
FT                   /product="conserved membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00727"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23762"
FT                   /protein_id="ACT23762.1"
FT                   /translation="MAGSDPPTGGPASQAGSDAGASPEHKHMSRRKHLVLDVCIILGVL
FT                   IAYVFSLLGYDWLAHTPGPLPQPDVGTTDDTVVLIRFEELHTVANRLDVKVLVLPDDSM
FT                   IDHRLQVLTTDTSVRLYPENELGDLQYPVGKLPAQVATTIEAHGNPGAWPFDTYTTDTV
FT                   QADVLVGAGDNRQYVPARVEVTGSLEGWDISAVRVGESSQTSDRPDNVIITLKRAKGPL
FT                   VFDLGICLVLITLPTLALFVAIQMITGRRKFQPPFGTWYAAMLFAVVPLRTILPGSPPA
FT                   GAWIDRAVVIWVLIALAAAMVVYIVAWYRESD"
     atggccggta gcgacccacc aacaggtggg ccggcgtcgc aggcgggttc agacgcggga        60
     gcctcgccag aacacaaaca catgtcgcgg cgaaagcacc tcgtgctcga tgtctgcatc       120
     atcctgggtg ttctcattgc ctacgtcttt tcgctgctcg gctacgactg gttggcccac       180
     acaccgggtc cgcttccgca gccggacgtg ggcacgactg acgacaccgt ggttttgatc       240
     cgcttcgagg agctgcacac tgtggcaaat cgcctcgatg tgaaagtgct ggtgctgccc       300
     gacgattcga tgatcgacca tcgcctccaa gtgttgacta ccgacacctc ggtgcggttg       360
     tatccggaga acgaactcgg agatctgcag tacccggtag gaaagctgcc cgcgcaagta       420
     gcgaccacga tcgaggcgca cggcaacccg ggcgcctggc cattcgatac atacaccacc       480
     gatacggtcc aggccgatgt gctcgtcggc gctggcgaca accgtcaata cgtacccgcc       540
     cgggtcgaag tgaccggatc gctggaaggc tgggacatca gcgccgtccg cgtcggggaa       600
     agcagccaaa cctctgatcg cccggacaat gtcatcatca ccctgaagag ggccaagggt       660
     ccgctggttt tcgacctggg catctgcctg gtgctgatca cattgccgac gttggccttg       720
     ttcgtggcca tccagatgat taccggccgc agaaaattcc aaccaccgtt cggcacttgg       780
     tacgccgcga tgttgttcgc tgtcgtgccg ctgcgcacta ttctcccggg ctcgccgccg       840
     gcgggtgcgt ggattgaccg ggccgttgtg atctgggtgc tcatagcgct ggcggcggcg       900
     atggtggtgt acatcgtcgc ctggtaccga gaatcggact aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page