(data stored in ACNUC7421 zone)

EMBL: CP001658.PE743

CP001658.PE743       Location/Qualifiers
FT   CDS_pept        812742..813059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00729"
FT                   /product="50S ribosomal protein L24 rplX"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00729"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23764"
FT                   /protein_id="ACT23764.1"
FT                   /translation="MKVHKGDTVLVISGKDKGAKGKVLQAYPDRNRVLVEGVNRIKKHT
FT                   AISTTQRGARSGGIVTQEAPIHVSNVMVVDSDGKPTRIGYRVDEETGKRVRISKRNGKD
FT                   I"
     atgaaggtcc acaaaggcga caccgtgctg gtgatttcgg gcaaagataa aggggccaag        60
     ggcaaagtct tgcaggcgta tccggaccgc aaccgggtat tggtcgaggg tgtcaaccgg       120
     atcaagaagc acaccgcgat ctcgaccacc cagcggggcg cgcgttcggg tgggatcgtc       180
     acccaggaag cgccgatcca tgtctccaac gtgatggtgg ttgactccga cggcaagccc       240
     acccgaatcg gctatcgggt cgacgaggag accggcaagc gcgtccgtat ctccaagcgc       300
     aacggcaagg acatttga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page