(data stored in ACNUC7421 zone)

EMBL: CP001658.PE744

CP001658.PE744       Location/Qualifiers
FT   CDS_pept        813059..813622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00730"
FT                   /product="50S ribosomal protein L5 rplE"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00730"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23765"
FT                   /protein_id="ACT23765.1"
FT                   /translation="MTTAQKVQPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNM
FT                   GVGEAARDAKLINGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMW
FT                   EFLDRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVRGMDINV
FT                   VTSAATDDEGRALLRALGFPFKEN"
     atgaccactg cacagaaggt tcagccgcgc ctcaaggagc gctaccgcag tgagattcgg        60
     gatgcgctgc gcaagcagtt cggctacggc aatgtcatgc agatcccgac ggtgacgaaa       120
     gtcgtcgtca acatgggtgt cggcgaggcc gcccgggacg ccaagttgat caacggggcg       180
     gtcaacgatt tggcgctgat caccgggcag aagccggaag tccgccgggc gcgcaagtcc       240
     atcgcgcagt tcaaattgcg tgagggcatg ccggtgggcg tccgagtcac gctgcgcggt       300
     gaccggatgt gggagttcct tgaccggctc acgtcgatcg cactgccacg catccgtgac       360
     ttccgtgggc tttcgcccaa acagttcgac ggtgtgggca actacacctt cgggctggcc       420
     gagcaggcgg tattccacga ggtcgacgtg gacaagattg accgggtccg tggcatggac       480
     atcaacgtcg tcacttccgc ggcgaccgac gacgaaggcc gagcgctgtt gcgggccctc       540
     ggctttccct tcaaggagaa ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page