(data stored in ACNUC7421 zone)

EMBL: CP001658.PE745

CP001658.PE745       Location/Qualifiers
FT   CDS_pept        813627..813809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00731"
FT                   /product="ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00731"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23766"
FT                   /protein_id="ACT23766.1"
FT                   /translation="MAKKALVNKAAGKPRFAVRAYTRCSKCGRPRAVYRKFGLCRICLR
FT                   EMAHAGELPGVQKSS"
     atggcgaaga aggcactggt caacaaggcc gcaggcaaac cgaggtttgc cgtgcgcgcc        60
     tacacccgtt gcagcaagtg cggccgcccg cgtgcggtct accgcaagtt cgggctgtgc       120
     aggatttgcc tgcgcgagat ggcgcacgcg ggtgagttgc ccggcgtgca gaagagcagc       180
     tag                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page