(data stored in ACNUC7421 zone)

EMBL: CP001658.PE746

CP001658.PE746       Location/Qualifiers
FT   CDS_pept        813976..814374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00732"
FT                   /product="30S ribosomal protein S8 rpsH"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00732"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23767"
FT                   /protein_id="ACT23767.1"
FT                   /translation="MTMTDPIADFLTRLRNANSAYHDEVSLPHSKLKANIAQILKNEGY
FT                   ISDFRTEDARVGKSLVIQLKYGPSRERSIAGLRRVSKPGLRVYAKSTNLPRVLGGLGVA
FT                   IISTSSGLLTDRQAARQGVGGEVLAYVW"
     atgacgatga cggacccgat cgcagacttt ttgacccgtc tgcgtaacgc caactcggcg        60
     tatcacgacg aggtcagctt gccgcactcc aagctcaagg ccaacatcgc gcagattctc       120
     aagaacgagg ggtacatcag cgacttccga accgaggacg ctcgggtcgg taaatcgctg       180
     gttatccagc tcaagtacgg ccctagccgg gagcgcagca tcgccgggtt gcggcgggtg       240
     tccaagcccg gcctgcgggt gtacgcgaaa tccaccaatc tgccgcgggt gctcggcggc       300
     ctgggcgtgg cgatcatctc gacctcctcg ggcctgctga ctgaccggca ggcagctaga       360
     cagggcgtgg gcggcgaagt cctcgcatat gtctggtga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page