(data stored in ACNUC7421 zone)

EMBL: CP001658.PE749

CP001658.PE749       Location/Qualifiers
FT   CDS_pept        815328..815990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00735"
FT                   /product="30S ribosomal protein S5 rpsE"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00735"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23770"
FT                   /protein_id="ACT23770.1"
FT                   /translation="MAEQPAGQAGTTDNRDARGDREGRRRDSGRGSRERDGEKSNYLER
FT                   VVAINRVSKVVKGGRRFSFTALVIVGDGNGMVGVGYGKAKEVPAAIAKGVEEARKSFFR
FT                   VPLIGGTITHPVQGEAAAGVVLLRPASPGTGVIAGGAARAVLECAGVHDILAKSLGSDN
FT                   AINVVHATVAALKLLQRPEEVAARRGLPIEDVAPAGMLKARRKSEALAASVLPDRTI"
     atggcggagc agccggccgg acaggcaggc actaccgaca accgtgacgc acggggtgat        60
     cgggagggcc ggcgccgcga cagcggccgc ggcagtcgtg aacgggatgg cgagaagagc       120
     aactatctag agcgggtcgt cgccatcaac cgcgtctcca aggtggtcaa gggtggtcgg       180
     cgcttcagct tcaccgcttt ggtcatcgtg ggcgacggta acgggatggt cggtgtcggc       240
     tacggcaagg ccaaggaagt accggccgcg atcgccaagg gcgtcgaaga ggcgcgcaaa       300
     agcttcttcc gggtaccgct gatcggcggc accatcacgc acccggtgca gggcgaggcg       360
     gccgccggtg tggtgttgct acggccggcc agcccgggta ccggtgtgat cgccggtggt       420
     gcggcccgcg cggtgctgga atgtgcgggg gtgcacgaca tcttggccaa gtcgctgggc       480
     agtgacaacg cgatcaatgt ggtgcacgcc accgtggccg cgctcaagct gctgcagcgt       540
     ccggaggagg tggcggcgcg ccgcggtttg ccgatagagg acgtcgcccc ggccgggatg       600
     ctgaaggcgc gtcggaaaag tgaagcgctg gccgccagcg ttttgccgga tagaacgata       660
     tag                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page