(data stored in ACNUC7421 zone)

EMBL: CP001658.PE750

CP001658.PE750       Location/Qualifiers
FT   CDS_pept        815993..816190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00736"
FT                   /product="50S ribosomal protein L30 rpmD"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00736"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23771"
FT                   /protein_id="ACT23771.1"
FT                   /translation="MSQLKITQVRSTIGARWKQRESLRTLGLRRIRHSVIREDNAATRG
FT                   LIAVVRHLVEVEPAQTGGKT"
     atgtcacagc tgaagatcac ccaggtgcgc agcaccatcg gagcacgctg gaagcagcgc        60
     gagagcctgc gcactctggg cttacgaagg attcgtcatt cggtgatccg cgaagacaac       120
     gcagcgactc gcggactgat cgcggtggtg cgtcacctcg tggaggttga gcccgcgcag       180
     accggaggga agacatag                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page