(data stored in ACNUC7421 zone)

EMBL: CP001658.PE759

CP001658.PE759       Location/Qualifiers
FT   CDS_pept        823866..824594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00744"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00744"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23780"
FT                   /protein_id="ACT23780.1"
FT                   /translation="MHGARTGVSFYAYAMTDHDQTAARREIADALLAALERRHEVADAI
FT                   VEAANKAAAVEAIVNLLGTSHLAAEAVMSMSFDQLTQDARTKIIAELDDLNKQLSFTVK
FT                   ERPASSGEGLELRPFSPDEDRDIFARRTEEMGAAGDGSGGPAGSVDDEIRAAQKRVDDE
FT                   EAAWFVAVDSGVKVGMVFGELVHGEVDVRIWIHPDHRKKGYGTAALRKSRSEMAWAFPA
FT                   VPMVARAPAAQPAQPGSAGR"
     atgcatggcg caagaactgg tgtgtcgttc tacgcttatg caatgacaga tcacgaccag        60
     accgcggccc gtcgagagat cgccgatgcc ctgctcgccg cgctggaacg tcggcatgag       120
     gtcgcagacg ccatcgtgga ggccgccaac aaggccgccg ccgtcgaggc gatcgtgaac       180
     ttgctgggca cctcgcactt ggccgccgaa gcggtgatga gcatgtcttt cgatcagctc       240
     acccaggatg cgcgcacaaa gatcatcgcc gagctcgacg acctgaacaa acagctgagc       300
     ttcaccgtca aggagcgtcc agccagctct ggtgagggcc tggagctgcg gccgttctcc       360
     ccagatgagg accgcgacat cttcgctcga cgaaccgaag aaatgggcgc cgccggcgat       420
     ggatccgggg gacccgccgg cagcgtcgac gacgagatcc gagccgcaca gaagcgcgtc       480
     gacgacgagg aggcggcttg gttcgtggct gttgattccg gcgtcaaggt cgggatggtg       540
     ttcggcgagc ttgtccacgg cgaggtggac gtccggatct ggattcaccc cgatcatcga       600
     aaaaagggtt acggaaccgc ggcattgcgc aagtcgcgct cggagatggc ctgggcgttc       660
     ccggccgtgc cgatggtcgc ccgcgcgccc gcggcccaac ccgcccagcc gggaagtgcc       720
     ggccggtag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page