(data stored in ACNUC7421 zone)

EMBL: CP001658.PE762

CP001658.PE762       Location/Qualifiers
FT   CDS_pept        827122..827667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00747"
FT                   /product="adenylate kinase adk"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00747"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23783"
FT                   /protein_id="ACT23783.1"
FT                   /translation="MRVLLLGPPGAGKGTQAVKLAEKLGIPQISTGELFRRNIEEGTKL
FT                   GVEAKRYLDAGDLVPSDLTNELVDDRLNNPDAANGFILDGYPRSVEQAKALHEMLERRG
FT                   TDIDAVLEFRVSEEVLLERLKGRGRADDTDDVILNRMKVYRDETAPLLEYYRDQLKTVD
FT                   AVGTMDEVFARALRALGK"
     gtgagagttt tgttgctggg accgcccggg gcgggcaagg ggacgcaggc ggtgaagctg        60
     gccgagaagc tcgggatccc gcagatctcc accggcgaac tcttccggcg caacatcgaa       120
     gagggcacca agctcggcgt ggaagccaaa cgctacttgg atgccggtga cttggtgccg       180
     tccgacttga ccaatgaact cgtcgacgac cggctgaaca atccggacgc ggccaacgga       240
     ttcatcttgg atggctatcc acgctcggtc gagcaggcca aggcgcttca cgagatgctc       300
     gaacgccggg ggaccgacat cgacgcggtg ctggagtttc gtgtgtccga ggaggtgttg       360
     ttggagcgac tcaaggggcg tggccgcgcc gacgacaccg acgacgtcat cctcaaccgg       420
     atgaaggtct accgcgacga gaccgcgccg ctgctggagt actaccgcga ccaattgaag       480
     accgtcgacg ccgtcggcac catggacgag gtgttcgccc gtgcgttgcg ggctctggga       540
     aagtag                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page