(data stored in ACNUC7421 zone)

EMBL: CP001658.PE767

CP001658.PE767       Location/Qualifiers
FT   CDS_pept        831062..831610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00752"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00752"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23788"
FT                   /protein_id="ACT23788.1"
FT                   /translation="MDPLMAHQRAQDAFAALLANVRADQLGGPTPCSEWTINDLIEHVV
FT                   GGNEQVGRWAASPIEPPARPDGLVAAHQAAAAVAHEIFAAPGGMSATFKLPLGEVPGQV
FT                   FIGLRTTDVLTHAWDLAAATGQSTDLDPELAVERLAAARALVGPQFRGPGKPFADEKPC
FT                   PRERPPADQLAAFLGRTVR"
     gtggacccac tgatggctca ccagcgcgct caggacgcgt tcgccgcgct cctggccaac        60
     gtccgcgctg accagctcgg cggccccacg ccctgctcgg agtggacgat caacgatctg       120
     atcgagcacg tcgtcggcgg caacgagcag gtcgggcgat gggcggccag ccccatcgag       180
     ccacccgccc ggcccgatgg cctcgttgcc gcccaccaag ccgcggccgc ggtcgcccac       240
     gagatcttcg cggcgccggg cgggatgtcc gccacattca agctgccgtt gggcgaggtt       300
     cccgggcagg tgttcatcgg gttacgcacc accgatgtgc tgacccacgc gtgggatctt       360
     gccgccgcca ccggccaatc caccgatctt gatcccgagt tggccgtcga gcggctcgcc       420
     gccgcgcgtg ccttggtggg gccgcagttc cgcgggccgg gaaagccctt cgcggacgag       480
     aagccttgcc cgcgtgagcg cccgcccgcc gatcagctgg cggcattttt gggccgcacg       540
     gtgcggtga                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page