(data stored in ACNUC7421 zone)

EMBL: CP001658.PE769

CP001658.PE769       Location/Qualifiers
FT   CDS_pept        832695..833303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00754"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00754"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23790"
FT                   /protein_id="ACT23790.1"
FT                   /translation="MTGPPRSYTGRRDLIAEKLEPYFQISAMLPKNTRPTSETAEEFWD
FT                   NSLWCSWGDRETGYTRTVTVSICQVADGEREAEGVRDMMRLECPAGLDLRTPNPEAYEI
FT                   TGQRPGEFVFVLGYLGHVRAIVGNCYIEIMPMGTRVELSKLADVALDIGRSVGCSAYEN
FT                   DFTLPDIPTQWRNQPLGWYTQGLAPYLPGLSDPKDAAEG"
     gtgaccgggc caccgcgaag ctatacaggg cgccgggatc tcatcgcgga gaagctggag        60
     ccgtactttc agatcagcgc catgctgccg aagaacacca gacccacctc ggaaaccgcc       120
     gaagagttct gggacaactc gctgtggtgc agctggggcg accgagaaac gggatacacc       180
     cgcaccgtca cggtttcgat ctgccaggtg gcggacggcg aacgtgaggc cgaaggggtt       240
     cgggacatga tgcggctgga gtgtccggct gggctggatc tacggacacc caacccggag       300
     gcatacgaga ttaccggtca gcggcccgga gaattcgtgt tcgtgctcgg ctatctgggg       360
     catgtgcggg ccatcgtggg caactgttac atcgagatca tgccgatggg caccagggtc       420
     gagctgagca agttggccga tgtggcattg gatatcggcc gcagtgtcgg atgctcggcc       480
     tacgagaacg acttcacgct gccggacatt ccaacgcagt ggcgcaacca gccgctgggc       540
     tggtacacgc aaggccttgc cccctacctg ccggggctgt cggacccgaa agacgccgcc       600
     gagggctga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page