(data stored in ACNUC7421 zone)

EMBL: CP001658.PE771

CP001658.PE771       Location/Qualifiers
FT   CDS_pept        833990..834508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00756"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00756"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23792"
FT                   /protein_id="ACT23792.1"
FT                   /translation="MIAAPEAIAAAATDLASIGSTIGAANAAAAANTTAVLAAGADQVS
FT                   VAIAAAFGAHGQAYQALSAQAATFHIQFVQALTAGAGSYAAAEAASAASITSPLLDAIN
FT                   APFLAALGRPLIGNGADGAPGTGAAGGAGGLLFGNGGAGGSGAPGGAGGLLFGNGGAGG
FT                   PGASGGALG"
     gtgatcgcgg cgccggaggc catcgcggca gcggccacgg atttggcaag catcggttcg        60
     acgatcgggg cggccaacgc cgcggccgcg gccaacacga cggcggtgct ggccgcgggc       120
     gccgatcagg tgtcggtggc catcgcggcg gcttttgggg cgcacggcca ggcctatcag       180
     gcgctcagcg cgcaggcggc gacgtttcat atccagtttg tgcaggcctt gaccgcgggc       240
     gcgggctcgt atgcggccgc cgaggccgcc agcgccgcgt ccataaccag tccgctgctc       300
     gacgcgatca acgcgccctt cctggcggcg ttggggcgcc cgctgatcgg taacggcgcc       360
     gacggggcgc cggggaccgg ggccgccggc ggggccggcg gattgttgtt cggcaacggc       420
     ggcgcgggcg ggtccggcgc gcccggcggg gccggcggat tgttgttcgg caacggcggc       480
     gccggcggcc ccggcgcgtc cggcggcgcg ctgggctga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page