(data stored in ACNUC7421 zone)

EMBL: CP001658.PE775

CP001658.PE775       Location/Qualifiers
FT   CDS_pept        836154..836681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00759"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00759"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23795"
FT                   /protein_id="ACT23795.1"
FT                   /translation="MGPPHRSRPPLPSPGPTCQVLPTTAVIHTVTAEALGRIGIDAPRI
FT                   PGSLDVAAHAAIGLLPLVAGCDRRHRRPVRGARAGRAAQVSLCMTAIRVEPVSSNAVCT
FT                   GPAAQVGDQSRSPQRDYAHQALQPDVPRRRARRHRPRRCSAKTGSSSSTMRCTCHQNQC
FT                   LWSSGVSWALAR"
     gtggggccgc cgcaccggtc gaggccaccg cttccatcgc caggcccaac atgccaggtg        60
     ctgccgacta cggcggtgat ccacacggtc acggcggaag cattgggccg catcggtatt       120
     gatgcgccgc ggattcctgg atcgttggac gtcgccgcgc atgcggcgat cgggctgctg       180
     ccgttggtgg ccggctgcga ccgccgacat cggcggcctg tccgcggtgc tcgggccgga       240
     cgggctgccc aagtgtcttt gtgtatgacg gctatccggg tggagccggt ttcgtcgaac       300
     gcggtttgca ccggccccgc ggcgcaggtg ggtgaccagt cacgctcacc gcagcgcgat       360
     tacgcgcacc aggccttgca acccgatgtg ccgcggcgcc gcgcgcggcg gcacagaccc       420
     cgccggtgtt cggcaaaaac ggggtcgtcg tcttcgacga tgcggtgtac ttgtcatcag       480
     aatcagtgtc tatggtcatc gggggtgtcg tgggcgctgg cccgctga                    528
//

If you have problems or comments...

PBIL Back to PBIL home page