(data stored in ACNUC7421 zone)

EMBL: CP001658.PE776

CP001658.PE776       Location/Qualifiers
FT   CDS_pept        836701..839052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00760"
FT                   /product="PE-PGRS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00760"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23797"
FT                   /protein_id="ACT23797.1"
FT                   /translation="MSFVLAMPEVLGSAATDLAALGSVLGAADAAAAATTTGIVAAAQD
FT                   EVSAAIAALFSAHGRAYQVASAQAAAVHAQFVEALSAGAGAYASAEAAGAAVLANPAQS
FT                   VQQDLLAAVNAQSVALTGRPLIGNGANGAPGTGANGAPGGWLLGNGGAGGSAAAGSGLP
FT                   GGAGGAAGLFGTGGAGGAGGSSTVGDGGAGGAGGSGGWLLGTGGVGGVGGLGAGAGGAG
FT                   GVGGAGGLLGAGGHGGAGGLGAVTGGVGGAGGAGGLLAGLLAGPGGAGGTGGRGFLNDG
FT                   GVGGAGGNAGLLFGAGGTGGSGGAGLGGDGGAGGAGGNAGVLFGNAGSGGTGGFGDTDG
FT                   GAGGAGGDAGWLGSGGVGGAGGFGETGDGGVGGAGGKAGLLIGNGGAGGAGGQGAVTGG
FT                   TGGAGGDGVLIGNGGNAGIGGTGPTAGDTGAGGISGLLLGADGFNAPASASPLHTLKQQ
FT                   ALAAINAPTQTLTGRPLIGNGTPGAVGSGATGAPGGWLLGDGGAGGSGAAGSGAPGGAG
FT                   GAAGLWGTGGAGGAGGSSAGGGGAGGAGGAGGWLLGDGGAGGIGGASTVLGGTGGGGGV
FT                   GGLWGAGGAGGAGGTGLVGGDGGAGGAGGTGGLLAGLIGAGGGHGGTGGLSTNGDGGVG
FT                   GAGGNAGMLAGPGGAGGAGGDGENLDTGGDGGAGGSAGLLFGSGGAGGAGGFGFLGGDG
FT                   GAGGNAGLLLSSGGAGGFGGFGTAGGVGGAGGNAGWLGFGGAGGVGGSAGLIGTGGNGG
FT                   NGGTGANAGSPGTGGAGGLLLGQNGLNGLP"
     atgtcgttcg tgctggcgat gccggaggtg ttggggtcgg cggcaacgga tctggccgct        60
     ctgggctcgg tgctgggcgc ggccgatgcg gccgcggcgg ctacgacgac gggcatcgtg       120
     gccgcggccc aggatgaggt gtcggcggcg atcgcggcgt tgttttccgc ccacggccgg       180
     gcctatcagg tggccagtgc gcaggcggcg gcggttcacg cccagttcgt ggaggcgttg       240
     agcgcgggtg cgggggccta cgccagcgcg gaggccgccg gcgcggcggt gctggccaac       300
     ccggcgcaga gcgtgcagca ggacctgctg gccgccgtca atgcgcaaag tgtcgcgctc       360
     acggggcgcc cgttgatcgg caacggcgcc aacggggccc cgggcacggg ggccaatggt       420
     gcgccgggcg ggtggttgct cggtaatggt ggggccggcg ggtccgccgc cgctggctcg       480
     ggcctgcccg gcggggccgg cggggccgcc gggttgttcg gcaccggcgg ggctggtggg       540
     gccggcggga gttccacggt aggtgatggc ggggccgggg gtgccggtgg gtcaggtggc       600
     tggttgttgg gcaccggtgg ggtcggcggg gtcggcgggc tcggggccgg cgccggtggg       660
     gccggcgggg ttggtggggc cggcgggctg ttgggtgctg gcgggcacgg cggcgccggc       720
     gggctcggcg ccgtcaccgg tggggtcggg ggagctggcg gagccggtgg gctgctggcc       780
     gggctgctgg ccgggccggg cggggccggc gggaccggcg gacgtggctt tctcaacgac       840
     ggtggggtcg gtggggctgg cggcaacgcc gggctgctgt tcggtgccgg cggcaccggt       900
     ggatccggcg gagccggcct aggtggtgac ggtggggccg gtggggccgg cggcaacgcc       960
     ggtgtgctgt tcggcaacgc cggatccggg gggaccggcg ggttcggcga taccgacggg      1020
     ggagccggcg gtgccggcgg tgacgccggc tggttgggct ccggtggggt cggcggggcc      1080
     ggcgggttcg gcgaaaccgg tgacgggggt gtcggcgggg ccggcggcaa ggccgggttg      1140
     ctgatcggta acggcggggc cggcggcgcc ggtgggcaag gcgccgtgac cggcggtacc      1200
     ggcggggccg gcggcgacgg ggtgctgatc ggcaacggcg gcaacgccgg catcggcgga      1260
     accggaccga ccgcgggtga taccggcgcg ggtgggatca gtgggctgct gctgggcgcc      1320
     gacggcttca acgccccggc cagcgcctct ccgctgcaca ccctgaaaca acaggcgctg      1380
     gccgcgatca acgcgccgac ccagacactg accgggcgac cgctgatcgg caacggcacc      1440
     cccggggcgg tcggcagcgg ggccaccggg gcccccggtg ggtggctgct cggcgacggc      1500
     ggggccggcg ggtccggcgc ggcgggctcg ggcgcgcccg gcggggcggg cggggctgcc      1560
     gggctgtggg gtaccggcgg ggccggcggg gccggaggca gctcggcggg tggcggcggg      1620
     gccggtgggg ccggcggggc cggcggctgg ctgctcggcg acggcggggc cggcgggatc      1680
     ggcggagcca gcaccgtact cggcggcacc ggcgggggag gcggggtcgg tgggctgtgg      1740
     ggcgccggtg gggccggcgg ggccggtgga accggccttg ttggtggcga cggcggggcc      1800
     ggtggggccg gcgggaccgg cggactgctg gccgggctga tcggtgccgg cggaggtcac      1860
     ggcgggaccg gcgggctcag cactaatggc gacggcgggg ttggcggggc cggcgggaat      1920
     gccggaatgc tcgccgggcc gggcggcgcc ggcggagccg gcggtgacgg cgaaaacctg      1980
     gacaccggtg gggacggcgg ggccggcggt agcgcagggc tgctgttcgg cagcggcggc      2040
     gccggcggcg ccggcggatt tggtttcctc ggtggggacg gcggggccgg tggcaacgcc      2100
     gggctgctgt tgtccagcgg cggggccggc gggttcggcg ggttcggcac cgccggtggg      2160
     gtcggtgggg ccggcggcaa tgccggctgg ctgggcttcg gcggggccgg tggcgtcggc      2220
     ggcagcgccg ggctgatcgg caccggcggc aacggcggca acggcggcac cggcgccaac      2280
     gccggcagcc ccggaaccgg cggcgccggc gggttgctgc tgggccaaaa cgggctcaac      2340
     gggttgccgt ag                                                          2352
//

If you have problems or comments...

PBIL Back to PBIL home page