(data stored in ACNUC7421 zone)

EMBL: CP001658.PE785

CP001658.PE785       Location/Qualifiers
FT   CDS_pept        complement(849301..851241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00769"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00769"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23806"
FT                   /protein_id="ACT23806.1"
FT                   /translation="MMVGFAWLPPETNSLRMYLGAGSRPLLAAAGAWDGLAEELHAAAS
FT                   SFGSVTSELAGGAWQGPASAAMANAAGPYASWLTAAGAQAELAARQARAAAGAFEEALA
FT                   GVVHPAVVQANRVRTWLLAVSNVFGQNAPAIAAMESTYEQMWAQDVAVMAGYHAASSAA
FT                   AAQLASWQPALPNINLGVGNIGNLNVGNGNTGDYNLGNGNLGNANFGGGNGSAFHGQIS
FT                   SFNVGSGNIGNFNLGSGNGNVGIGPSSFNVGSGNIGNANVGGGNSGDNNFGFGNFGNAN
FT                   IGIGNAGPNMSSPAVPTPGNGNVGIGNGGNGNFGGGNTGNANIGLGNVGDGNVGFGNSG
FT                   SYNFGFGNTGNNNIGIGLTGSNQIGFGGLNSGSGNIGFGNSGTGNIGFFNSGSGNFGVG
FT                   NSGVTNTGVANSGNINTGFGNSGFINTGFGNALSVNTGFGNSGQANTGIGNAGDFNTGN
FT                   FNGGIINTGSFNSGAFNSGSFNGGDANSGFLNSGLTNTGFANSGNINTGGFNAGNLNTG
FT                   FGNTTDGLGENSGFGNAGSGNSGFNNSGRGNSGAQNVGNLQISGFANSGQSVTGYNNSV
FT                   SVTSGFGNKGTGLFSGFMSGFGNTGFLQSGFGNLEANPDNNSATSGFGNSGKQDSGGFN
FT                   SIDFVSGFFHR"
     gtgatggtcg gtttcgcgtg gttgcctccg gagaccaatt cgctacggat gtatctgggt        60
     gcggggtcac ggccactatt ggcggcggcg ggggcctggg acgggttggc cgaggagttg       120
     cacgcggcgg cgtcgtcgtt cgggtcggtg acgtcggagt tggccggcgg cgcttggcag       180
     ggaccggcgt cggccgcgat ggcgaatgcc gcggggccgt atgcgagctg gttgaccgcg       240
     gctggagccc aggccgagct ggcagcgcgg caggctcggg cggcggcggg tgcatttgag       300
     gaggcgctgg ccggcgtggt gcatccggcg gtggtgcagg ccaatcgtgt tcggacgtgg       360
     ttgttggcgg tgtcgaatgt gttcgggcaa aacgcgccgg ccatagcggc catggaatcc       420
     acctacgagc agatgtgggc acaagacgtg gcggtgatgg ccggctacca tgccgcatcc       480
     tcggcggcag cggcacagct ggcgtcgtgg cagccggcgt tgccaaacat caatttgggt       540
     gtcggcaata tcggcaacct caatgtcggc aatggtaata ccggcgatta caacctgggt       600
     aatggaaacc tcggtaacgc caactttggc ggcggaaacg gaagcgcctt ccacggccag       660
     atttccagct tcaacgtggg tagcggcaac atcggcaact tcaacctggg tagcggaaac       720
     ggaaacgttg gcatcggacc gtccagcttt aacgtgggta gcggcaacat cggtaatgcg       780
     aacgtcgggg gtggcaactc tggcgacaac aacttcggct tcgggaactt tggcaatgcc       840
     aacattggta tcggaaatgc aggtccaaac atgagttccc ccgccgtgcc cacccccggc       900
     aatgggaatg tcgggattgg caacggtggc aatggaaact tcggcggtgg taacacgggc       960
     aacgcaaata tcggtctggg aaacgtaggc gacggcaacg ttggcttcgg gaacagcggc      1020
     agctacaact tcggcttcgg gaacaccggc aacaataata tcggcattgg gttaaccggc      1080
     agcaatcaga tcggctttgg cggactgaat tccggtagcg gtaatatagg atttggtaac      1140
     tcgggcaccg ggaacatcgg cttcttcaac tcgggcagcg gcaacttcgg cgtgggcaac      1200
     tcgggcgtca ccaacacggg cgtagccaac tcaggcaaca tcaacaccgg cttcggaaac      1260
     tccggcttta tcaacaccgg cttcgggaac gcgttaagcg tcaacactgg ctttggcaac      1320
     tcaggtcagg ccaataccgg catagggaac gcgggcgatt tcaacaccgg caacttcaac      1380
     ggcggcatca ttaacaccgg tagcttcaac tcgggtgcat tcaactcagg cagcttcaac      1440
     ggaggagacg ctaattctgg tttcttgaac tctggcctga cgaacaccgg cttcgcaaat      1500
     tctggcaata tcaacacggg cggctttaac gcgggcaacc tgaacaccgg tttcggcaat      1560
     actaccgatg ggctgggcga aaactcggga ttcggaaacg ccggcagtgg aaattcgggt      1620
     ttcaataatt ctggtagggg aaactccggc gcccaaaacg ttggtaattt acaaatctcg      1680
     ggcttcgcca actcgggcca atcggtaacg ggttacaaca attcggttag tgtaacatcg      1740
     ggtttcggga acaagggaac cggcctgttc agtggattca tgtcgggctt tggcaatacg      1800
     ggttttctac agtcgggctt cggtaatctt gaagccaatc ccgacaacaa cagcgccaca      1860
     tcgggtttcg ggaactctgg aaagcaggat tctggtggct ttaattcgat cgatttcgtg      1920
     tcgggctttt tccaccgcta g                                                1941
//

If you have problems or comments...

PBIL Back to PBIL home page