(data stored in ACNUC7421 zone)

EMBL: CP001658.PE789

CP001658.PE789       Location/Qualifiers
FT   CDS_pept        853594..855051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00773"
FT                   /product="two component system sensor kinase phoR"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00773"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23810"
FT                   /protein_id="ACT23810.1"
FT                   /translation="MARHLRGRLPLRVRLVAATLILVATGLVASGIAVTSMLQHRLTSR
FT                   IDRVLLEEAQIWAQITLPLAPDPYPGHNPDRPPSRFYVRVISPDGQSYTALNDNTAIPA
FT                   VPANNDVGRHPTTLPSIGGSKTLWRAVSVRASDGYLTTVAIDLADVRSTVRSLVLLQVG
FT                   IGSAVLVVLGVAGYAVVRRSLRPLAEFEQTAAAIGAGQLDRRVPQWHPRTEVGRLSLAL
FT                   NGMLAQIQRAVASAESSAEKARDSEDRMRQFITDASHELRTPLTTIRGFAELYRQGAAR
FT                   DVGMLLSRIESEASRMGLLVDDLLLLARLDAHRPLELCRVDLLALASDAAHDARAMDPK
FT                   RRITLEVLDGPGTPEVLGDESRLRQVLRNLVANAIQHTPESADVTVRVGTEGDDAILEV
FT                   ADDGPGMSQEDALRVFERFYRADSSRARASGGTGLGLSIVDSLVAAHGGAVTVTTALGE
FT                   GCCFRVSLPRVSDVDQLSLTPVVPGPP"
     atggccagac accttcgagg aaggctgccc ctacgggtac gcctggtcgc agccacgctg        60
     atcctggtgg ccactggact tgtggcctcg gggatcgcgg tcacctcgat gttgcagcac       120
     cggctgacca gccggatcga tcgggtgttg ctcgaggaag cccaaatctg ggcgcagatc       180
     acgctgccct tggcgccgga cccctaccct ggtcataacc ccgatcggcc gccgtcgagg       240
     ttctacgttc gggtgatcag ccccgacggc cagagctata cggcactcaa cgacaacact       300
     gccataccgg cggtgcccgc caacaatgat gtcggccggc acccgacgac gctgccatcg       360
     atcggcggat ccaagacttt atggcgcgcg gtctcggtgc gcgcgtcgga tggctacttg       420
     accaccgtcg ccattgatct ggccgacgtc cggagcaccg tgcggtcact ggtgctgttg       480
     caggtcggca taggcagtgc ggtgctggtt gtcctcgggg tggcgggcta cgctgtggtt       540
     cgccgcagcc tgcggccgct ggcagaattc gagcagacgg ccgcggcgat cggcgcgggg       600
     cagctggatc gccgggtccc gcagtggcat ccgcgaactg aggtcggccg gctttcgttg       660
     gcgctcaacg gaatgctggc acaaattcag cgggcggtgg cgtccgcgga atcttccgcc       720
     gaaaaggccc gggattcaga ggaccggatg cgacagttca tcaccgacgc cagccatgaa       780
     ctgcgtaccc cgttgaccac tatccgcggc ttcgcggagc tgtaccgaca aggagccgcc       840
     cgcgacgtgg gcatgctgct gtcgcggatt gagagcgaag cgagccggat ggggctgctg       900
     gtggacgatt tgctgctgct tgcccggcta gatgcgcacc ggccgttgga actgtgccgg       960
     gtggacctgc tggcgctggc cagtgatgcc gcgcacgacg cgcgggcgat ggaccccaaa      1020
     cgcaggatca ccctggaggt ccttgacggc cccggcaccc cggaggtcct cggcgacgaa      1080
     tcgcggcttc ggcaggtgct gcgcaatctc gttgcaaatg ccatacagca caccccggaa      1140
     agcgccgacg tcaccgtgcg agtcggcacc gagggcgacg acgccatcct cgaggtcgcc      1200
     gatgacggtc cgggcatgag tcaggaggat gcgctgcggg tgttcgagcg gttctatcgc      1260
     gccgactcgt cgcgggcgcg cgccagcggc gggaccggac tggggttgtc gatcgtcgac      1320
     tctttggtgg cggcccatgg cggagcggtc accgtgacga ccgcgctcgg ggagggttgc      1380
     tgctttcgtg tctcgctgcc gcgcgtcagt gacgtggacc agctgagcct cacgccagtt      1440
     gtgccagggc cgccctga                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page