(data stored in ACNUC7421 zone)

EMBL: CP001658.PE790

CP001658.PE790       Location/Qualifiers
FT   CDS_pept        complement(855023..855424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00774"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00774"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23811"
FT                   /protein_id="ACT23811.1"
FT                   /translation="MSIFTKIINRELPGRFVYEDDDVVAFLTIEPMTQGHTLVVPRAEI
FT                   DHWQNVDPALFGRVMSVSQLIGKAVCRAFSTQRAGMIIAGLEVPHLHIHVFPTRSLSDF
FT                   GFANVDRNPSPGSLDEAQAKIRAALAQLA"
     gtgtcgatct tcaccaagat catcaaccgt gaactgcccg gccgtttcgt ctacgaggac        60
     gacgacgtcg tggcgttctt gacgattgag ccgatgacgc aaggccacac cttggtggtg       120
     ccacgcgccg aaatcgacca ctggcaaaac gtggatcccg cgttatttgg ccgcgtcatg       180
     tcggtgagcc agctgatcgg caaggccgtg tgccgggcgt tttcaaccca acgcgccggg       240
     atgatcattg ccgggctgga agtgccccac ctacacatcc acgtgtttcc cacccgcagc       300
     ctcagtgatt tcggctttgc caacgtcgac cgcaacccct caccgggatc gctggacgaa       360
     gcgcaggcca agatcagggc ggccctggca caactggcgt ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page