(data stored in ACNUC7421 zone)

EMBL: CP001658.PE791

CP001658.PE791       Location/Qualifiers
FT   CDS_pept        complement(855464..855883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00775"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00775"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23812"
FT                   /protein_id="ACT23812.1"
FT                   /translation="MTQTTQSPALIASQSSWRCVQAHDREGWLALMADDVVIEDPIGKS
FT                   VTNPDGSGIKGKEAVGAFFDTHIAANRLTVTCEETFPSSSPDEIAHILVLHSEFDGGFT
FT                   SEVRGVFTYRVNKAGLITNMRGYWNLDMMTFGNQE"
     atgacccaaa cgacccaatc cccggccctg atcgcgtcgc agtcgtcgtg gcggtgcgtc        60
     caagcccacg accgggaggg ctggctggcg ctgatggccg acgacgtcgt catcgaggat       120
     ccgatcggca agtccgtcac caatcccgat ggcagcggca tcaaaggtaa ggaggccgtc       180
     ggcgccttct tcgacacaca cattgcggcc aatcggttga cggtcacctg cgaggagacg       240
     ttcccgtcca gctcaccgga cgagatcgcc cacattctgg tgttgcacag cgagtttgac       300
     ggcggcttta ccagtgaggt ccgcggcgtg ttcacctacc gggtgaataa ggccggtttg       360
     atcaccaaca tgcgtgggta ctggaacctc gacatgatga ccttcggtaa ccaggaatga       420
//

If you have problems or comments...

PBIL Back to PBIL home page