(data stored in ACNUC7421 zone)

EMBL: CP001658.PE806

CP001658.PE806       Location/Qualifiers
FT   CDS_pept        869606..870229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00790"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23827"
FT                   /protein_id="ACT23827.1"
FT                   /translation="MGVTAAVTPKGERRRYALVSAAAELLGEGGFEAVRHRAVARRAGL
FT                   PLASTTYYFSSLDDLIARAVEHIGMIEVAQLRARVSALSRRRRGPETTAVVLVDLLVGE
FT                   MSSPGLAEQLISRYERHIACTRLPDLRESMRRSLRQRAEAVAEAIERSGRSAQIELVCT
FT                   LICAVDGSVVSALVEGRDPRAAALATVVDLIDVLAPVDQRPVPF"
     atgggcgtga cagcagcggt cactccaaaa ggagaacgtc ggcggtatgc gttggtcagc        60
     gccgccgcgg agctgctcgg cgagggcggg ttcgaggcgg tacgccaccg ggcggtggcg       120
     cggcgggccg gtttgccgtt ggcgtctacc acctactact tctcgtcgct cgacgatttg       180
     atcgctcgcg cggtcgaaca catcggaatg atcgaggtgg ctcagctgcg agcccgggtc       240
     agtgcgctgt cccggcgacg tcgggggccc gagaccaccg ccgttgtgct ggttgacctg       300
     ctggtggggg aaatgtccag tccggggctt gccgagcagc tgatctcacg atacgagcgc       360
     catatcgcct gtacccgcct gcctgacctg cgcgaaagca tgcgccgcag cctgcgtcag       420
     cgcgctgagg ccgtggccga ggccatcgag cgctccggcc gctccgcaca gatcgaactg       480
     gtgtgtacgt tgatctgtgc ggtcgacgga tcggtggtct cggcgctggt cgaagggcgg       540
     gacccgcgtg ccgctgcgct ggcgacggtg gtcgacctca tcgacgtgct cgcgcccgtc       600
     gaccagcgtc cggtgccgtt ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page