(data stored in ACNUC7421 zone)

EMBL: CP001658.PE807

CP001658.PE807       Location/Qualifiers
FT   CDS_pept        complement(870183..870962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00791"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00791"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23828"
FT                   /protein_id="ACT23828.1"
FT                   /translation="MYFVGVDLAWAGRNPTGVAAVDADGCLVGVGAARDDASVLAALRP
FT                   YVVGDCLVAFDAPLVVANRTGQRPAEAALNRDFRQFEAGAYPANTEKPEFADVPRAARL
FT                   ARQLALDMDPLSSATRRAIEVYPHPATVALFRLPRALKYKAKPGRSVDLLKSELLRLMD
FT                   GVEGLAQAGVRMQVAGQPDWVSLRRQVTVAQRKSDLRAAEDPIDAVVCAYVALYAQRRP
FT                   ADVTIYGDFTTGYIVTPSLPTDFRTAPDAGRRARARR"
     atgtacttcg tcggcgtgga cctcgcctgg gccggccgca atccgaccgg tgtcgcggct        60
     gtcgacgcgg acgggtgtct ggtgggggtc ggtgccgctc gcgacgatgc ctccgtgctg       120
     gcggcgctgc ggccctacgt tgtgggcgat tgcctggtcg ccttcgacgc gccgctggtg       180
     gtggccaacc gcaccggcca gcggccggcg gaggccgcac tgaatcgaga cttccgacaa       240
     ttcgaggccg gcgcgtatcc ggccaacacc gaaaagcccg agtttgccga cgttccacgc       300
     gccgcccggc tggcccgcca actggcgctg gatatggatc ctctttcgtc cgccacgcgg       360
     cgggccatcg aggtctatcc gcacccggct acggtggcgc tgtttcggct accccgcgcg       420
     ctgaagtaca aggccaagcc gggacgcagc gttgacctgc tcaaatcgga gctattgcga       480
     ctgatggacg gcgtcgaggg gctcgcccag gccggggttc ggatgcaggt agccggtcag       540
     ccggattggg tctcgttgcg ccggcaggtg acggtcgcgc agcgaaaaag cgacctgcgg       600
     gccgccgagg atccgatcga cgccgtcgta tgcgcctacg tggcgttgta cgcccaacgc       660
     cggcccgccg atgtcacgat ctatggggac ttcaccaccg ggtacattgt cacgccgtcg       720
     ctgcccaccg acttcagaac ggcaccggac gctggtcgac gggcgcgagc acgtcgatga       780
//

If you have problems or comments...

PBIL Back to PBIL home page