(data stored in ACNUC7421 zone)

EMBL: CP001658.PE816

CP001658.PE816       Location/Qualifiers
FT   CDS_pept        879821..880525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00799"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00799"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23837"
FT                   /protein_id="ACT23837.1"
FT                   /translation="MSGKLLVSVSGIGESTLADVDAFCAEMDARSVPVSLLVAPRMRDD
FT                   YRLDRDPRTVDWLTGRRAAGDALVLHGYDEAATKRRRGEFAMLRAHEANLRLMAADRVL
FT                   EHLGLRTRLFAAPGWLVSPGVRTALPANGFRLLADLHGITDLVRLTTVRARVLGIGEGF
FT                   LAEPWWCRMVVMSAERIARRGGVVRIAVAARHLRKSGPLQAMLDAVDLAMLQGCTPMVY
FT                   RWRADAAVLDAA"
     gtgtctggaa aactgctcgt gtcggtctcg gggataggtg agagcaccct ggccgatgtc        60
     gacgcgttct gcgcggaaat ggacgcccgc tcggtgccgg tatcgttgct ggtggctccg       120
     cgtatgcgcg atgactaccg gctcgaccgc gacccacgca ccgtcgactg gctgaccggt       180
     cgccgggccg ccggcgacgc tctggtactg catggctacg acgaagcggc caccaagagg       240
     cggcgcggcg aattcgcaat gctgcgcgca cacgaggcca acctgcggct gatggccgcc       300
     gaccgggtgc tcgaacacct tgggctgcga acccgactgt ttgcggcacc gggctggctg       360
     gtatcaccag gtgtccgtac agcgttgccg gccaatggat ttcggctgct tgcggatctc       420
     catggaatca cggatctggt tcggctcacc accgtgcgtg cccgcgtgct gggcatcggc       480
     gagggtttcc tggcggagcc ctggtggtgc cggatggtgg tgatgtcggc cgagcggatc       540
     gcccggcgtg ggggcgtcgt ccggattgcg gtggccgccc gtcatttgcg caagtccggt       600
     ccgctgcagg cgatgctcga tgccgtcgac ctggcgatgc tgcaggggtg cacaccgatg       660
     gtgtaccggt ggcgagccga tgcggcggta ctcgacgcgg cctga                       705
//

If you have problems or comments...

PBIL Back to PBIL home page