(data stored in ACNUC7421 zone)

EMBL: CP001658.PE819

CP001658.PE819       Location/Qualifiers
FT   CDS_pept        882660..883619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00802"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00802"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23839"
FT                   /protein_id="ACT23839.1"
FT                   /translation="MHRPPWLAQLRRRLRIGVQLGSRVVLEQGRQPRDVYVIGVLVGDQ
FT                   DRGQTGDSLEAVRESTGIEEQAGLTELSEEAGMAEMRELHVYDCALMGAFPMRLILATM
FT                   LVAGRLLATLMAAPSAQAEPETCPPICDQIPATAWISTHAVPLNSQYRWPAMAGAAVAV
FT                   TRATPRFGFEQVCATPAFPHDSRDWAVAGRVTVVHPDGQWQLQAQVLHWRGDTARGGQI
FT                   AASVFGTAVAALRACQLGAPLQSPSVTDDEPTRMAAVISGPVIMHTYLVAHVSSSTISE
FT                   LTLWSSGPPQVPWPTVADSAVLDALTAPLCEAYIGSCP"
     gtgcaccgcc cgccatggct cgcccagctg cgccgccgtc tgcggatcgg cgtacagctc        60
     ggcagccggg ttgtcctcga gcagggtcgg cagccgcgtg acgtctatgt gatcggggtg       120
     ctggtgggtg atcaagatcg cggacaaacc ggtgattccc tcgaagccgt gcgagaaagt       180
     accgggatcg aagagcaggc gggtttgacc gaactcagcg aggaggcagg aatggccgaa       240
     atgcgtgagt tgcatgttta cgattgtgcc cttatggggg cgtttccgat gcggttgatc       300
     ctggcgacga tgctggtcgc cggtcgcttg ttggcgacgc tcatggccgc gcctagcgcc       360
     caggctgagc cggaaacctg cccgccgata tgcgaccaga ttcctgctac cgcgtggatc       420
     agcacccacg ccgtgccgtt gaactcgcaa taccgttggc cggcaatggc cggcgcggca       480
     gtggcggtga ccagggcgac accacgtttc gggttcgagc aggtgtgcgc cacgccggcg       540
     ttcccgcacg acagccgcga ttgggcggtc gcgggccggg tcacggtggt ccaccccgac       600
     ggccagtggc agttgcaggc tcaggtgctg cactggcgcg gggacaccgc ccgcggtggc       660
     cagatcgcgg cgtcggtgtt tggcaccgcc gtcgccgcgt tacgcgcctg ccagctgggc       720
     gcaccgctgc agtcgccgtc ggtcaccgac gacgaaccga cccggatggc cgcggtgatc       780
     agcgggccgg tcatcatgca cacctacctg gtcgcgcacg tatcaagcag cacgatcagc       840
     gaactcacct tgtggtcgtc cgggccgcca caagttccgt ggcctacggt tgcggactcc       900
     gcggttctgg acgccctgac cgcgccgtta tgcgaagcct acatcggctc gtgcccgtga       960
//

If you have problems or comments...

PBIL Back to PBIL home page