(data stored in ACNUC7421 zone)

EMBL: CP001658.PE823

CP001658.PE823       Location/Qualifiers
FT   CDS_pept        complement(885273..886001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00806"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00806"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23844"
FT                   /protein_id="ACT23844.1"
FT                   /translation="MTLANNGTGMDHFLTPTEYLDAGHPLVRTTAATLIRDAVSDTKRV
FT                   RRIYYYVRDVPYDVLASFRYLAQGHHRASDVIGHGVASCMGKASSFVALCRAAGVPARI
FT                   AFQTIDAPDKEFLSPQVRALWGGRTGRPFPWHSLGEAYLGRRWVKLDATIDAPTAARLG
FT                   KPYRQEFDGATPIPTVEGTILRENGSYADYPSAVAQWYERIAQSVLKALQSTEVHALVA
FT                   ADEELWTGPPVELADATHRL"
     atgacgctag ccaacaatgg aaccggcatg gaccactttc tgacgcccac ggagtacctc        60
     gacgcgggcc atccgctcgt tcgtacgacg gcagcaaccc tcatccggga cgcggtgtcg       120
     gataccaagc gggtcaggcg gatctactac tacgtgcgcg acgtgccata cgacgtcctc       180
     gcgtcctttc gctacctcgc gcagggacat caccgcgcca gcgacgtgat cggccacggg       240
     gtcgcctcct gcatgggcaa ggcaagttcc ttcgtcgccc tgtgccgagc cgccggtgtc       300
     ccggcccgta tcgcgttcca gacgatcgac gcccccgata aggagtttct gtccccgcag       360
     gtacgtgccc tatggggagg ccgaactggc cggcccttcc cgtggcactc gctgggtgag       420
     gcatatcttg gtcggcgatg ggtcaagctg gacgccacca tcgacgcacc caccgccgcc       480
     cgcctcggca agccctaccg gcaagaattc gacggagcta ccccgatccc gacggtggaa       540
     ggaaccatcc tgcgggaaaa cggcagctac gccgactatc ccagcgcggt cgcgcaatgg       600
     tacgaacgaa tcgctcagtc ggtcctgaag gcgttgcagt ccaccgaagt acacgccttg       660
     gtagccgctg acgaggaact gtggaccggc cccccggttg aattggccga cgcaacccac       720
     cgactgtga                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page