(data stored in ACNUC7421 zone)

EMBL: CP001658.PE824

CP001658.PE824       Location/Qualifiers
FT   CDS_pept        complement(885998..887041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00807"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00807"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23845"
FT                   /protein_id="ACT23845.1"
FT                   /translation="MNAKDDPHFGLMLAATVNGLAVGSYREMVVVSQTAEEYGFDSVWL
FT                   CDHFLTISPGEYAKVAGIAADTGSATGTETGGAGQCAPSRSLPLLECWTALAALCRDTT
FT                   KLRLGTSVLCNSYRHPSVLAKMAATLDVISQGRLDLGLGAGWFRRESQAYGIPFPPVGD
FT                   RVSALAESLQVIKAVWTEPNPTYAGRFYTLDGATCDPPPVQRPHPPLWIGGEGDRVQRI
FT                   AAKHAQGLNVRWWSPQQVTQRRGFLTQASEAAGRDPDTLRLSVTLLLAPTQSGEEEVRI
FT                   REEFASIPEPGLIVGTPDRCVERIREYQDRGVGHFLFTIPHVVKSDYLHIIGSDIIPRV
FT                   KTEVTIP"
     atgaacgcca aagacgaccc gcacttcgga ctcatgttgg ctgcgacggt taatggcctg        60
     gcggtcggca gttaccgcga aatggttgtc gtctcgcaga cggcggaaga atacggattc       120
     gattcagtgt ggttatgcga ccacttcctg acgataagcc ccggcgagta tgcgaaggtc       180
     gccggcatcg ccgccgacac cggctccgcg accggcaccg aaaccggcgg ggcgggccag       240
     tgcgcccctt cgaggtcgct gcccctgctc gagtgctgga ccgcacttgc ggcattgtgc       300
     cgcgacacca cgaagctgcg gttgggcacc agcgtgctgt gcaattccta ccgtcatcct       360
     tccgtgctgg ccaagatggc tgcgacgctg gacgtcattt cccagggacg tctcgatctg       420
     ggattgggcg ccggctggtt tcggcgcgag tcgcaagcct acggcatccc gttcccgccg       480
     gttggcgacc gagtctccgc gcttgccgag tcgctgcagg tcatcaaggc cgtgtggacc       540
     gagccaaacc ccacctacgc cggccggttt tacaccttgg acggcgccac ctgcgatccg       600
     ccgccggtgc aacggccaca tcctccgttg tggatcggcg gggaaggcga ccgggtccag       660
     cgcatcgccg ctaagcatgc ccagggcctg aacgtgcgct ggtggtcgcc gcagcaagtc       720
     acccaacgcc gcggatttct cacccaggcg tcggaggcgg ccgggcgtga ccccgacacg       780
     ctgcgactgt cggtcacgct gctgctggca cccacccagt ccggcgagga agaagtccgg       840
     atccgcgaag aattcgcgtc catccccgag ccggggctca tcgtcgggac acccgacagg       900
     tgtgtcgagc gcattcgtga ataccaggac cgcggtgtcg gccattttct cttcacgatt       960
     ccacacgtcg tgaagtccga ttatctgcac atcatcggca gtgacatcat tccgcgggtc      1020
     aaaactgagg tcacgattcc atga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page