(data stored in ACNUC7421 zone)

EMBL: CP001658.PE91

CP001658.PE91        Location/Qualifiers
FT   CDS_pept        97058..97732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00089"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23112"
FT                   /protein_id="ACT23112.1"
FT                   /translation="MSVYKHAPSRVRLRQTRSTVVKGRSGSLSWRRVRTGDLGLAVWGG
FT                   REEYRAVKPGTPGIQPKGDMMTVTVVDAGPGRVSRSVEVAAPAAELFAIVADPRRHREL
FT                   DGSGTVRGNIKVPAKLVVGSKFSTKMKLFGLPYRITSRVTALKPNELVEWSHPLGHRWR
FT                   WEFESLSPTLTRVTETFDYHAAGAIKNGLKFYEMTGFAKSNAAGIEATLAKLSDQYARG
FT                   RA"
     gtgtcggtgt acaaacacgc accctcgcgg gttcggttgc gccaaactag aagtaccgtg        60
     gtcaagggac gttcggggag cctgtcgtgg cgtcgagtgc gcaccggtga cctcggtctg       120
     gctgtttggg gtggacgcga ggagtaccgg gcggtcaaac cgggcacacc agggatacaa       180
     ccgaagggag acatgatgac tgtgaccgtt gtcgatgctg gacccggccg ggtgagccgt       240
     tcggtggagg tggccgcgcc ggcggccgag ttgttcgcca tcgttgctga tccccggcgc       300
     caccgcgaac tggacggatc gggcacggtt cgcggcaaca tcaaggtacc ggcgaaatta       360
     gttgtcgggt cgaagttttc gacgaagatg aagttgttcg gcctaccgta tcgcatcacc       420
     agcagggtga ccgcgctcaa accgaacgaa ttggtcgagt ggagccaccc gttaggccat       480
     cggtggagat gggaattcga atcgctgtca ccgacactga cccgcgtcac cgagacattc       540
     gactaccacg ccgccggtgc gatcaagaac ggcctgaagt tctacgagat gacgggtttc       600
     gcgaagtcca atgcggcggg aatcgaggcc acgttggcca agctgagcga tcagtacgcc       660
     cgcggtaggg catga                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page