(data stored in ACNUC7421 zone)

EMBL: CP001658.PE93

CP001658.PE93        Location/Qualifiers
FT   CDS_pept        98611..99381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00091"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23114"
FT                   /protein_id="ACT23114.1"
FT                   /translation="MAKNQNRIRNRWELITCGLGGHVTYAPDDAALAARLRASTGLGEV
FT                   WRCLRCGDFALGGPQGRGAPEDAPLIMRGKALRQAIIIRALGVERLVRALVLALAAWAV
FT                   WEFRGARGAIQATLDRDLPVLRAAGFKVDQMTVIHALEKALAAKPSTLALITGMLAAYA
FT                   VLQAVEGVGLWLLKRWGEYFAVVATSIFLPLEVHDLAKGITTTRVVTFSINVAAVVYLL
FT                   ISKRLFGVRGGRKAYDVERRGEQLLDLERAAMLT"
     gtggccaaga accaaaaccg catccgcaac cggtgggagt tgatcacctg tggtctcggg        60
     ggacacgtca cctacgcgcc ggacgacgcg gcacttgctg cgcggctgcg cgccagcacc       120
     gggctgggcg aagtatggcg ctgcttgcgc tgcggcgatt tcgcgctcgg tgggccgcag       180
     gggcgtggtg ctcccgagga tgcgccgttg attatgcgcg gcaaggcgtt acgtcaggcc       240
     atcatcattc gcgcgctcgg ggtcgaacgg ctagtccggg cgttggtgtt ggcgctggcc       300
     gcgtgggcgg tgtgggagtt tcgcggtgcg cggggagcta tccaggcgac cctggatagg       360
     gacttgccgg tcctgcgtgc ggccggattc aaggtcgatc aaatgacggt gatccacgct       420
     ctggagaaag cgttggccgc caaaccgtcg acgttggccc tgatcacggg catgctggcg       480
     gcatacgcag tgctgcaggc cgtcgagggg gtcggtttgt ggctgctgaa gcgctggggc       540
     gagtacttcg cggtggtggc cacctcaatt ttcctgccgt tggaggttca cgacctggcc       600
     aagggcatca cgacgactcg ggtcgtgacc ttcagcatca atgtcgccgc cgttgtctac       660
     ctgctgattt ctaagcggtt gttcggtgtg cgcggcgggc gcaaggctta tgacgtcgaa       720
     cggcgcggcg agcagctgct cgacctcgag cgcgccgcga tgctcacctg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page