(data stored in ACNUC7421 zone)

EMBL: CP001658.PE97

CP001658.PE97        Location/Qualifiers
FT   CDS_pept        complement(103841..104800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23118"
FT                   /protein_id="ACT23118.1"
FT                   /translation="MDVSTRQAAEADLAGKAAQYRPDELARYAQRVMDWLHPDGDLTDT
FT                   ERARKRGITLSNQQYDGMSRLSGYLTPQARATFEAVLAKLAAPGATNPDDHTPVIDTTP
FT                   DAAAIDRDTRSQAQRNHDGLLAGLRALIASGKLGQHNGLPVSIVVTTTLTDLQTGAGKG
FT                   FTGGGTLLPMADVIRMTSHAHHYSPASGRYPQAIFDHGTPLALYHTKRLASPAQRIMLF
FT                   ANDRGCTKPGCDAPAYHSQAHHVTAWTSTGRTDITELTLACGPDNRLAEKGWTTHNNTH
FT                   GHTEWLPPPHLDHGQPRTNTFHHPERFLHNQDDDDKPD"
     gtggatgtgt ccacccgcca ggccgccgaa gccgacctgg ccggcaaagc cgctcaatat        60
     cgtcccgacg agctggcccg ctacgcccag cgggtcatgg actggctaca ccccgacggc       120
     gacctcaccg acaccgaacg cgcccgcaaa cgcggcatca ccctgagcaa ccagcaatac       180
     gacggcatgt cacggctaag tggctacctg accccccaag cgcgggccac ctttgaagcc       240
     gtgctagcca aactggccgc ccccggcgcg accaaccccg acgaccacac cccggtcatc       300
     gacaccaccc ccgatgcggc cgccatcgac cgcgacaccc gcagccaagc ccaacgcaac       360
     cacgacgggc tgctggccgg gctgcgcgcg ctgatcgcct ccgggaaact gggccaacac       420
     aacggtcttc ccgtctcgat cgtggtcacc accaccctga ccgacctgca aaccggcgcc       480
     ggcaagggct tcaccggcgg cggcaccctg ctacccatgg ccgatgtgat ccgcatgacc       540
     agccacgccc accactactc ccccgcaagc gggaggtacc cccaggcgat cttcgaccac       600
     ggcacacccc tggcgctgta tcacaccaaa cgcctagcct ccccggccca gcggatcatg       660
     ctgttcgcca acgaccgcgg ctgcaccaaa cccggctgtg acgcaccggc ctaccacagc       720
     caagcccacc acgtcaccgc ctggaccagc accggacgca ccgacatcac cgagctgacc       780
     ctggcctgcg gccccgacaa ccgactcgcc gaaaaaggct ggaccaccca caacaacacc       840
     cacggccaca ccgaatggct accaccaccc cacctcgacc acggccaacc ccgcaccaac       900
     accttccacc accccgaacg attcctccac aaccaagacg acgacgacaa acccgattga       960
//

If you have problems or comments...

PBIL Back to PBIL home page