(data stored in ACNUC7421 zone)

EMBL: CP001658.PE99

CP001658.PE99        Location/Qualifiers
FT   CDS_pept        105455..106846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBMG_00097"
FT                   /product="PPE family protein"
FT                   /db_xref="EnsemblGenomes-Gn:TBMG_00097"
FT                   /db_xref="EnsemblGenomes-Tr:ACT23120"
FT                   /protein_id="ACT23120.1"
FT                   /translation="MAIPPEVHSGLLSAGCGPGSLLVAAQQWQELSDQYALACAELGQL
FT                   LGEVQASSWQGTAATQYVAAHGPYLAWLEQTAINSAVTAAQHVAAAAAYCSALAAMPTP
FT                   AELAANHAIHGVLIATNFFGINTVPIALNEADYVRMWLQAADTMAAYQAVADAATVAVP
FT                   STQPAPPIRAPGGDAADTRLDVLSSIGQLIRDILDFIANPYKYFLEFFEQFGFSPAVTV
FT                   VLALVALQLYDFLWYPYYASYGLLLLPFFTPTLSALTALSALIHLLNLPPAGLLPIAAA
FT                   LGPGDQWGANLAVAVTPATAAVPGGSPPTSNPAPAAPSSNSVGSASAAPGISYAVPGLA
FT                   PPGVSSGPKAGTKSPDTAADTLATAGAARPGLARAHRRKRSESGVGIRGYRDEFLDATA
FT                   TVDAATDVPAPANAAGSQGAGTLGFAGTAPTTSGAAAGMVQLSSHSTSTTVPLLPTTWT
FT                   TDAEQ"
     atggctatac caccggaggt gcactcgggc ctgttgagcg ccgggtgcgg tccgggatca        60
     ttgcttgttg ccgcgcagca gtggcaagaa cttagtgatc agtacgcact cgcatgcgcc       120
     gagttgggcc aattgttggg cgaggttcag gccagcagct ggcagggaac cgccgccacc       180
     cagtacgtgg ctgcccatgg cccctatctg gcctggcttg agcaaaccgc gatcaacagc       240
     gccgtcaccg ccgcacagca cgtagcggct gccgctgcct actgcagcgc cctggccgcg       300
     atgcccaccc cagcagagct ggccgccaac cacgccattc atggcgttct gatcgccacc       360
     aacttcttcg ggatcaacac cgttccgatc gcgctcaacg aagccgatta tgtccgcatg       420
     tggctgcaag ccgccgacac catggccgcc taccaggccg tcgccgatgc ggccacggtg       480
     gccgtaccgt ccacccaacc ggcgccaccg atccgcgcgc ccggcggcga tgccgcagat       540
     acccggctag acgtattgag ttcaattggt cagctcatcc gggatatctt ggatttcatt       600
     gccaacccgt acaagtattt tctggagttt ttcgagcaat tcggcttcag cccggccgta       660
     acggtcgtcc ttgcccttgt tgccctgcag ctgtacgact ttctttggta tccctattac       720
     gcctcgtacg gcctgctcct gcttccgttc ttcactccca ccttgagcgc gttgaccgcc       780
     ctaagcgcgc tgatccattt gctgaacctg cccccggctg gactgcttcc tatcgccgca       840
     gcgctcggtc ccggcgacca atggggcgca aacttggctg tggctgtcac gccggccacg       900
     gcggccgtgc ccggcggaag cccgcccacc agcaaccccg cgcccgccgc tcccagctcg       960
     aactcggttg gcagcgcttc ggctgcaccc ggcatcagct atgccgtgcc cggcctggcg      1020
     ccacccgggg ttagctctgg ccctaaagcc ggcaccaaat cacctgacac cgccgccgac      1080
     acccttgcaa ccgcgggcgc agcacgaccg ggcctcgccc gagcccaccg aagaaagcgc      1140
     agcgaaagcg gcgtcgggat acgcggttac cgcgacgaat ttttggacgc gaccgccacg      1200
     gtggacgccg ctacggatgt gcccgctccc gccaacgcgg ctggcagtca aggtgccggc      1260
     actctcggct ttgccggtac cgcaccgaca accagcggcg ccgcggccgg aatggttcaa      1320
     ctgtcgtcgc acagcacaag cactacagtc ccgttgctgc ccactacctg gacaaccgac      1380
     gccgaacaat ga                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page