(data stored in ACNUC7421 zone)

EMBL: CP001700.PE1

CP001700.PE1         Location/Qualifiers
FT   CDS_pept        370..2082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: fra:Francci3_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA; Chromosomal replication initiator DnaA
FT                   domain; SMART: Chromosomal replication initiator DnaA
FT                   domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68956"
FT                   /db_xref="GOA:C7QFL7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFL7"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACU68956.1"
FT                   /translation="MPARRYHQGRQHRMEPQAVSDPQGYTPVPHPPAAPGDAIALWSHF
FT                   RARVESDSSLTKSEQAFLMIPEARTVIGDTIVLAVPDDFSKNYLEQRLEPMLTTHLAAM
FT                   FGPDIKFSLFVDKIMENTPAPAAAGPVAPPAPVIQQLAPPPAHWTPPPAMQSGAELQVP
FT                   AAFHSDPPAFAPDVPRPGLGGMALPPPRVSEPAPEENDPIAATLSLSTGRPGARSSTPD
FT                   DGAKAQQAKLNEKYVFETFVIGSSNRFAHAAAVAVAEAPAKAYNPLFIYGDSGLGKTHL
FT                   LHAIGHYARNLYPGTRVRYVSTEEFTNDFINAIRDGAGNHLRKRYRDVDILMVDDIQFL
FT                   ENKEGTQEEFFHTFNTLHNASKQIVISSDRPPKQLNTLEDRLRSRFEWGLITDIQPPEL
FT                   ETRIAILRKKAQQEGLNAPPEVLEFIASKISTNIRELEGALIRVTAFASLNRAPVDLSL
FT                   AEDVLKNLMPDAAGPEITVSTIMAQTAMYFGITMEDLCGTSRSRILVTARQIAMYLCRE
FT                   LTDLSLPKIGQAFGGRDHTTVMHADRKIRSLLPERRAIFNQVTELTNRIKQSG"
     atgccggccc gccggtacca ccagggccga cagcacagaa tggagccgca ggccgtgtcc        60
     gacccgcaag gctacacccc ggtcccgcac ccgccggccg cccctggcga cgccatcgcc       120
     ctgtggtccc acttccgcgc ccgcgtggag tccgacagct cgctgaccaa gagcgaacag       180
     gccttcctga tgatcccgga ggcccggacc gtgatcggcg acacgatcgt gctcgccgtc       240
     ccggacgact tctccaagaa ctatctggag cagcggctcg agccgatgct gaccacccat       300
     ctggccgcta tgttcggccc ggacatcaag ttcagcctgt tcgtcgacaa gatcatggag       360
     aacaccccgg cgccggccgc ggccggcccg gtcgcgccgc ccgccccggt catccagcag       420
     ctcgctccgc ccccggcgca ctggacgccg ccgccggcga tgcagtccgg cgccgaactg       480
     caggtcccgg cggctttcca cagcgatccg ccggccttcg cccccgacgt gccccgtccc       540
     ggactcggcg gcatggccct gcccccgccg cgcgtctccg agcccgcccc cgaggagaac       600
     gatccgatag cggccacgct gtcgctgtcc acaggccgtc ccggagcacg ctcctcgacg       660
     cccgacgacg gcgccaaggc ccagcaggcc aagctcaatg agaaatacgt cttcgagacc       720
     ttcgtcatcg gctccagcaa ccggttcgcg cacgccgcgg cggtcgccgt cgccgaggcg       780
     ccggccaagg cctacaaccc gctgttcatc tacggcgact ccggcctggg caagacccac       840
     ctgctccacg cgatcggcca ctacgcgcgc aacctgtatc cgggcacccg cgtgcgctac       900
     gtgtcgaccg aggagttcac caacgacttc atcaacgcga tccgcgacgg tgcgggcaac       960
     cacctgcgca agcgctaccg cgatgtcgac atcctgatgg tcgacgacat ccagttcctg      1020
     gagaacaagg aggggacgca ggaggagttc ttccacacgt tcaacaccct ccacaacgcc      1080
     tccaagcaga tcgtcatctc cagcgaccgg ccgcccaagc agctgaacac cctggaggac      1140
     cggcttcggt cgcggttcga gtggggtctg atcaccgaca tccagccgcc cgagttggag      1200
     acgcggatcg cgatccttcg caagaaggcg cagcaggaag gcctgaacgc gccgccggag      1260
     gtcctggagt tcatcgcctc gaagatctcc accaacatcc gcgaactgga gggcgcgctg      1320
     atccgggtca ccgcgttcgc ctcgctgaac cgggcgcctg tcgacttgtc gctggccgag      1380
     gacgtcctga agaacctgat gcccgacgcg gccggtccgg agatcacggt ctcgacgatc      1440
     atggcgcaga ccgcgatgta tttcgggatc accatggagg acctctgcgg gacttcccgc      1500
     agccgcatcc tggtgaccgc ccggcagatc gccatgtatt tgtgtcggga gctgaccgac      1560
     ctgtcactgc ccaagatcgg gcaggcgttc ggcggccggg atcacaccac ggtcatgcac      1620
     gccgaccgca agatccgctc gctgctcccc gagcgccgcg ccatcttcaa ccaggtcacc      1680
     gagctcacca accgcatcaa acagtccggc tga                                   1713
//

If you have problems or comments...

PBIL Back to PBIL home page