(data stored in ACNUC7421 zone)

EMBL: CP001700.PE10

CP001700.PE10        Location/Qualifiers
FT   CDS_pept        complement(14277..14699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0010"
FT                   /product="Curculin domain protein (mannose-binding) lectin"
FT                   /note="PFAM: Curculin domain protein (mannose-binding)
FT                   lectin; SMART: Curculin domain protein (mannose-binding)
FT                   lectin; KEGG: pfl:PFL_2127 putidacin L1"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU68965"
FT                   /db_xref="GOA:C7QFM6"
FT                   /db_xref="InterPro:IPR001480"
FT                   /db_xref="InterPro:IPR036426"
FT                   /db_xref="UniProtKB/TrEMBL:C7QFM6"
FT                   /inference="protein motif:PFAM:PF01453"
FT                   /protein_id="ACU68965.1"
FT                   /translation="MVKRTIGAIAGAAALAAALSVAGTGTALAATGGDHLNKGDTMYAN
FT                   DDIHNPAGTKLVFQPDGNLVEYRYDGHVCWATGTNGRGGTRVTYQNDGNLVMYASTDDS
FT                   RPIWASGTSGDNGLNVNINARGEIWVGYDQLTNACE"
     atggtgaagc gcaccatcgg agcgatcgcc ggagcagcgg cactcgccgc agccctctca        60
     gtggccggca ccggcaccgc cctcgccgcc accggcggag accacctgaa caagggcgac       120
     acgatgtacg ccaacgacga catccacaac cccgccggca ccaaactcgt cttccagccc       180
     gacggcaacc tcgtggaata ccgctacgac ggccacgtct gctgggccac cggcaccaac       240
     ggccgaggcg gcacccgcgt cacctaccag aacgacggca acctggtcat gtacgccagc       300
     accgacgact cccgccccat ctgggcctcc ggcaccagcg gcgacaacgg cctcaacgtc       360
     aacatcaacg cccgcggcga gatctgggtc ggctacgacc agctcacgaa cgcatgtgag       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page