(data stored in ACNUC7421 zone)

EMBL: CP001700.PE100

CP001700.PE100       Location/Qualifiers
FT   CDS_pept        103647..105341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0100"
FT                   /product="Allophanate hydrolase subunit 2"
FT                   /note="PFAM: Allophanate hydrolase subunit 2; Allophanate
FT                   hydrolase subunit 1; SMART: Allophanate hydrolase subunit
FT                   2; Allophanate hydrolase subunit 1; KEGG: aau:AAur_0053
FT                   UreA carboxylase/allophanate hydrolase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69055"
FT                   /db_xref="GOA:C7QHB6"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB6"
FT                   /inference="protein motif:PFAM:PF02626"
FT                   /protein_id="ACU69055.1"
FT                   /translation="MLPAGPFGVLLEFDSLDKVQRCFAWVERWRTARPGVLVDVVPAEQ
FT                   TLMAIATFDDAGQRGLREFVAAVGAVDWADAGTDDDAAPAADAETVELPVTYDGPDLDD
FT                   VTRLTGLAANEIVSLHTEAEFTVAFTGFAPGFAYLTGLPDALRVPRRDAPRTRVPTGAV
FT                   ALGGPYSGVYPRESPGGWQLIGQLAPWAPTLWDETRESPALLRPGTRVRFVDAAGQSAP
FT                   DSSAPAKLTQATAAATEPGLRVVRAGPLTTVQDLGRPGFAHLGVPRSGAVDRTSLKLAN
FT                   RLVGNEEGAAALELTLGGGAVQLEVGRWVAVTGARCEITMTVPAPESALEPAAAREVGP
FT                   DRKSAPAAGPSHRPIVMRTVPGTAFYAPEGAVVEVGPAVAGVRAYLAMAGGVGGFEVLG
FT                   SRSVDLLSGVGGRALGGGARVGVGVPVGLPPDIPGLGMAPVRDVGDPVVVRLVLGPRSE
FT                   WFTDDAVRDLVAARWTVGVESNRTAVRLDGPSLARARDGEPASEPLVVGAVQVPRDGRP
FT                   LLFLADHPVTGGYPVIACAHPADVDAAGQARPGTGIRFRMVGGLASR"
     gtgttacccg cgggcccatt cggggtactg ctcgagttcg attctttgga caaagttcag        60
     cgctgcttcg catgggtcga gcgctggcgc acggcgcggc cgggagtgct ggtcgatgtg       120
     gtgcccgccg agcagacgct gatggccatc gcgacgttcg acgacgcggg gcagcgcggg       180
     ttgcgggagt tcgtcgcggc ggtcggggct gtggactggg ctgatgccgg tacggacgat       240
     gacgcggcac ctgccgcaga cgccgagact gtcgaactcc cggtgacgta cgacggccca       300
     gatctggacg atgtgacccg cctgaccggg cttgccgcaa acgagatcgt ttcgttgcac       360
     acggaagccg aattcaccgt cgcgttcaca ggtttcgcgc cgggcttcgc gtacctgacc       420
     ggcttgccgg acgcgctacg cgtgccccgc cgcgatgcgc cgcgcacccg cgtgccgacc       480
     ggagcggtgg cattgggtgg gccgtacagc ggcgtctatc cgcgcgaatc cccgggcggc       540
     tggcagctga tcgggcaact ggcgccatgg gccccgacac tgtgggacga gacgcgggaa       600
     tcgccggccc tgctgcggcc aggcacacgg gtccggttcg tcgacgcagc cgggcaaagc       660
     gctccggaca gcagcgctcc cgccaagctg acgcaggcca ccgcggcagc cacggaaccc       720
     ggcctgcggg tggtccgcgc cggaccactg acgaccgtgc aggacctcgg ccgaccgggc       780
     ttcgcgcacc tcggcgtgcc acgctcagga gcggtcgacc ggacatcgct gaagctcgcc       840
     aaccgcttgg tgggcaacga agagggcgcc gcagccctcg agctgacact tggcggcgga       900
     gcggtgcagc tcgaagtcgg acgctgggtc gcggttaccg gggcacggtg cgagatcacg       960
     atgacggtgc cggcacccga gtcggcgctt gagcctgccg ccgctcgcga ggtcggccct      1020
     gatcgaaagt ccgcacccgc agccgggccc tcccaccggc cgattgttat gcgaactgtg      1080
     ccaggcactg ctttttatgc gcctgagggc gccgtggttg aggtggggcc ggcggtggcg      1140
     ggggtgcgcg cttaccttgc catggccggt ggggtggggg gttttgaggt gttggggagt      1200
     cggtccgttg atctcctttc gggggttggg gggcgggctc tggggggcgg ggcgcgggtc      1260
     ggtgtgggcg tgccggtggg gttgccgccg gatatcccgg ggttggggat ggcaccggtg      1320
     cgggatgtgg gggatccggt ggtggtgcgg ttggttttgg ggccccggag tgagtggttc      1380
     acggatgacg cggtgcggga tctggttgcg gcgcggtgga cggtgggagt ggagtcgaat      1440
     cggaccgcgg tgcggttgga cgggccttcg ttggcgcggg cgcgtgatgg ggagcccgcc      1500
     agcgagcctt tggtcgtggg ggctgtgcag gtgcctcggg atgggcggcc gctgctgttc      1560
     ttggccgacc atccggtgac cggggggtat ccggtgatcg cgtgtgccca tccggcggat      1620
     gtggatgccg cggggcaggc gcgaccgggg acggggatcc ggttccggat ggtcggtggg      1680
     ctggcttcgc ggtga                                                       1695
//

If you have problems or comments...

PBIL Back to PBIL home page