(data stored in ACNUC7421 zone)

EMBL: CP001700.PE101

CP001700.PE101       Location/Qualifiers
FT   CDS_pept        complement(105382..106392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0101"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: stp:Strop_1435 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69056"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69056.1"
FT                   /translation="MPTQTQPWLRAELIAAPETTPGAQLMIPADGVEFHDDQLVFHHQG
FT                   DIVYVAAQGQLRSITWFARQPNPETARRKAQWPNHGTRWTDEERADLRRHLSTGHSWKT
FT                   ISHAHGRSRSGCQQEAVKQGWLDPETLQPTPELLLEAAAPIPDTAAAPAAPAAPADHAA
FT                   PSTNDSHPLSVAASDSTSATASVAASNSVSDSTSGAASDSTPGAESPAIPMHSPAAPHA
FT                   PTPLIFTGSEAAPTPAHAAATPVSHSAVAQPDRPRIPPRVPRQRTGPTTEPHPGPDPGG
FT                   TSSQDSDPDTGDSPGATPSPGTRFLSRAQSSLARATLGAYMNPPRGQSDPASSPT"
     atgcccaccc aaacccaacc ctggctccga gcggaactca tagccgcccc cgaaaccacc        60
     cccggcgccc agctgatgat cccggccgac ggcgtggagt tccacgacga ccaactcgtc       120
     ttccaccacc aaggcgacat cgtctacgtg gccgcccagg gccagctccg ctccatcacc       180
     tggttcgcca gacagcccaa ccccgaaaca gcccgccgca aggcccaatg gcccaaccac       240
     ggcacccgct ggaccgacga ggaaagagcg gacctccgcc gccacctcag caccggccac       300
     agctggaaga ccatctccca cgcccacggc cgctcccgct cgggctgtca gcaggaagcc       360
     gtcaaacaag gctggctgga ccccgaaacc ctgcaaccga caccagaact cttactcgaa       420
     gcagccgccc cgatccccga caccgccgca gcccccgcag cgcccgcagc gcccgcagac       480
     cacgcagcgc catcaacgaa cgacagccac ccactctcgg tcgccgcctc ggattccacc       540
     tcggccactg catcggtcgc tgcctcgaat tcggtctcag attccacttc gggcgctgcc       600
     tccgattcca ccccgggtgc cgaatccccc gcgatcccca tgcactcgcc cgccgcccca       660
     cacgccccca cccccctgat cttcacgggg tcagaggccg ccccaacgcc cgctcacgcg       720
     gcagcgactc ccgtgtccca cagcgccgtc gcacagccgg accgaccacg aatccccccg       780
     cgcgtccccc gccagcgaac cggtcccacc accgagcccc accccggccc agacccgggc       840
     ggcacctctt cgcaggactc tgatcccgac accggcgaca gcccaggcgc cactcccagc       900
     cccggcacac gcttcctgtc ccgcgcacag tcctcactgg cccgcgccac actcggggcg       960
     tacatgaacc cgccacgcgg ccaatcagac ccggcgtcca gcccgacctg a               1011
//

If you have problems or comments...

PBIL Back to PBIL home page