(data stored in ACNUC7421 zone)

EMBL: CP001700.PE102

CP001700.PE102       Location/Qualifiers
FT   CDS_pept        complement(106496..106774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0102"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nfa:nfa32830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69057"
FT                   /db_xref="GOA:C7QHB8"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69057.1"
FT                   /translation="MTTQAPQPPPASQPPRTAADKAQRSRMIGAIVIAVVAIWFILANT
FT                   RKASITFWIVTVTSPMWLTLAGTFLAGMLTSLLLTRTRTRKRQKQPQ"
     atgacgaccc aagcgcccca gcccccgccg gcctcgcaac ccccgcgcac cgcggccgac        60
     aaggcccagc gctcgcgcat gatcggcgcc atcgtcatcg cggtggtggc catctggttc       120
     atcctggcca acacccgcaa ggccagcatc accttctgga tcgtcacagt gaccagcccc       180
     atgtggctca ccctcgccgg caccttcctc gccggcatgc tgaccagcct cctgctgacc       240
     cgcacccgca ctcgcaagcg ccagaagcag ccgcaataa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page