(data stored in ACNUC7421 zone)

EMBL: CP001700.PE103

CP001700.PE103       Location/Qualifiers
FT   CDS_pept        complement(106844..107413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0103"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; protein of
FT                   unknown function DUF1707; SMART: Forkhead-associated
FT                   protein; KEGG: sma:SAV_2158 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69058"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHB9"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACU69058.1"
FT                   /translation="MGGPSFGNAGWQPPDFRPSDAERDNAIDALSAGAEAGRLSSDTFS
FT                   HRLDQALAVQSHSELTQLVSDLPIPADQPGFGQRVVNAVSAVAHFRFKVKAAWRGPSLP
FT                   RLSLPGGPQVTLRIGRMPECDLQLFDTTVSRYHAEFRRSQNGWFLVDLGSTNGTRVNGW
FT                   RITAPTAVQPGDEVSFGSVVFSLNGR"
     atgggaggtc cttcgttcgg gaacgccgga tggcagccgc cggactttcg gccgtcggac        60
     gccgagcgcg acaacgccat cgacgcgctg tcggccggcg ccgaagccgg ccgcctgtcc       120
     agcgacacct tttcgcaccg cctggaccag gccctggcgg tgcagtcaca cagcgagctg       180
     acccagctcg tctccgacct gccgatcccg gccgaccagc cgggcttcgg ccagcgcgtg       240
     gtgaacgcgg tctcggccgt cgcgcacttc cgcttcaagg tcaaggcagc ctggcgcgga       300
     ccttccctgc cccgcctgtc cctccccggc ggcccgcagg tcaccctccg catcggccgc       360
     atgcccgaat gcgacctgca gctgttcgac accacggtgt cccgctacca cgccgagttc       420
     cgccgctccc agaacggctg gttcctggtg gacctgggct ccaccaacgg cacccgggtc       480
     aacggctggc gcatcaccgc tcccaccgcc gtgcaacccg gcgacgaggt ctccttcggc       540
     tcagtggtct tctccctgaa cggccgctga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page