(data stored in ACNUC7421 zone)

EMBL: CP001700.PE104

CP001700.PE104       Location/Qualifiers
FT   CDS_pept        complement(107482..108756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0104"
FT                   /product="proteinase inhibitor I4 serpin"
FT                   /note="PFAM: proteinase inhibitor I4 serpin; SMART:
FT                   proteinase inhibitor I4 serpin; KEGG: scl:sce4096 secreted
FT                   serine (or cysteine) proteinase inhibitor, clade B
FT                   (ovalbumin), member"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69059"
FT                   /db_xref="GOA:C7QHC0"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="InterPro:IPR036186"
FT                   /db_xref="InterPro:IPR042178"
FT                   /db_xref="InterPro:IPR042185"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC0"
FT                   /inference="protein motif:PFAM:PF00079"
FT                   /protein_id="ACU69059.1"
FT                   /translation="MPRKQIAAITAASLAALTACSSSGSSSSAGGSLVRVNAARATVGQ
FT                   ADLSAASAGVNAFGVDVFHSVADGDEGNVMISPTSLATVLTMLLPGAKGQTEAQMAKAL
FT                   HTTMTADQFADALGALDSATVQRELADKAELQQYDTVWTQKGYDIQPSYLQTLASAFDA
FT                   GVRETDFTNSESARQTINKTVEDQTNGLIKDLFGPGSISPATRLALTDSLYLKAKWADA
FT                   FAKSATSDKPFHLTNGSTANVPTMGKEHSFAYAHGADWQYAELPYQQDHLAMGILLPAS
FT                   GSFDTFRKSLTGDSLATMTASATPSPVDLELPKFTFDTSRDLKSPLESLGMQTVFDPNS
FT                   ADLSGVPAKPESLFVGAVVQKTHVAVDEDGTTAAAASGVTVVAGAAPQQSPPAEMHVDR
FT                   PFLFLIRDTVTGQILFLGQVSDPRG"
     atgccacgca agcagatagc cgcgatcacc gccgcatccc tcgccgccct gacggcgtgc        60
     tcgtcctccg gaagctcttc gtcggcgggc ggctccctgg tgcgcgtcaa cgccgcgcgg       120
     gcgaccgtcg ggcaggccga tctgagcgcc gcctcggccg gcgtgaacgc gttcggcgtc       180
     gacgtcttcc actccgtcgc cgacggcgac gagggcaacg tcatgatctc gccgaccagc       240
     ctggccacgg tgctgacgat gctgctgccc ggcgcgaagg ggcagaccga ggcccagatg       300
     gccaaggccc tgcacaccac catgaccgcc gaccagttcg ccgacgcgct cggcgccctg       360
     gactcggcga ccgtgcagcg cgagctcgcc gacaaggcag agctgcagca gtacgacacc       420
     gtgtggacgc agaagggata cgacattcag ccgtcctatc tccagaccct cgcctcggcc       480
     ttcgacgccg gcgtccgcga gaccgacttc acgaactccg agagcgcgcg ccagacgatc       540
     aacaagaccg tcgaggatca gaccaacgga ctcatcaagg acctcttcgg tccgggctcc       600
     atcagtcccg cgacccggct cgccctcacc gattccctat atctcaaggc gaagtgggcc       660
     gacgcgttcg ccaagagcgc gacctcggac aagccgttcc acctgacgaa cggcagcacc       720
     gcgaacgtcc cgacgatggg caaggagcac agcttcgcct acgcccacgg cgccgactgg       780
     cagtacgcgg agctgccgta ccagcaagat cacctggcga tgggcatcct tctcccggca       840
     tccgggtcct tcgacacctt ccgcaagtcg ctcaccggcg acagcctcgc cacgatgacc       900
     gcctcggcca cgccgtcccc ggtcgacctc gagctgccga agttcacgtt cgacaccagc       960
     cgcgatctga agtctccgct ggagtccctg ggcatgcaga ctgtcttcga cccgaactcg      1020
     gcggacctga gcggggtccc ggccaaaccc gagtcgctgt tcgtcggagc cgtcgtgcag      1080
     aagacccacg tcgccgtcga cgaggacggc accacagcgg ccgcggcctc gggcgtcacc      1140
     gtcgtcgccg gcgccgcgcc gcagcagtcc ccgccggcgg aaatgcacgt cgaccggcct      1200
     ttcctcttct tgatcaggga caccgtgacg ggccagatcc tgttcctggg ccaggtgagc      1260
     gacccacgcg gctga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page