(data stored in ACNUC7421 zone)

EMBL: CP001700.PE105

CP001700.PE105       Location/Qualifiers
FT   CDS_pept        108837..109391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0105"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro03411 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69060"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU69060.1"
FT                   /translation="MNAMTVPPMSSPAMPQNQEQEGPGEAVDIPQQQDAEPRQEEMPAV
FT                   TAAETEPGGGAGETGEPAADGDEGKEPAADAGETSGDRDEKEEKEDKDEKKTAAKPKRK
FT                   SAPRKTAGGSKTLVVLKGGRVQYADTDAVVVVDLDEAASPDTDVHDVLDRLTELRDATE
FT                   SPAKTDAVRALTDLIQEKALG"
     atgaacgcca tgaccgtgcc cccgatgtct tccccggcga tgccgcagaa ccaggaacag        60
     gaaggacccg gggaagccgt tgacatcccg cagcagcagg acgccgaacc gcgccaggag       120
     gaaatgccgg cggtaaccgc tgccgagacg gagccgggag gcggagccgg cgagaccgga       180
     gagcctgccg ccgacgggga cgagggcaaa gagcctgctg ccgacgccgg tgagaccagc       240
     ggggacagag acgagaagga agagaaggaa gacaaggacg agaagaagac ggcggccaag       300
     ccgaagcgca agagtgctcc gcgcaagacc gccggcggca gcaagaccct cgtcgtcctg       360
     aagggcggcc gggtccagta cgccgacacc gacgcggtgg tcgtggtgga cctcgacgag       420
     gccgcctccc ccgacaccga cgtacacgac gtcctggacc ggctcacgga gctgcgggac       480
     gcgaccgagt cgccggccaa gacggacgcc gtcagagctc tgacagacct gatccaggag       540
     aaggccctgg gctag                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page