(data stored in ACNUC7421 zone)

EMBL: CP001700.PE106

CP001700.PE106       Location/Qualifiers
FT   CDS_pept        complement(109615..110286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0106"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: fre:Franean1_3917
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69061"
FT                   /db_xref="GOA:C7QHC2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC2"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACU69061.1"
FT                   /translation="MDIYEALYTTRAMRRVKPDPIPESVQARILDAAIRAPSGGNGQNW
FT                   RFLLLDDPEKKKLLGPLYRDALDQLYTTVYAPMLAAIAADPDSPESRQMAKVTKSSRWL
FT                   GENFEQVPLFLFAFVQRDRSGGSIFPAVWNAQLAARAQGVGSALTSILGGFHDQEVKEI
FT                   LGVPAEEKWTQSCCVSFGYPTGRWGVAPRRPAHEVAYRNGWGEPVGFTVDEPLWQPSPE
FT                   S"
     atggacattt acgaagcgct ctacaccacc cgggccatgc gccgggtcaa gcccgacccg        60
     atcccggagt ccgtccaggc ccgcatcctg gacgccgcga tccgcgcgcc ctccggcggc       120
     aacgggcaga actggcggtt cctgctcctc gacgaccccg agaagaagaa gctcctcggc       180
     ccgctctacc gcgacgccct cgaccagctc tacacgacgg tctacgcccc gatgctggcc       240
     gcgatcgccg ccgacccgga cagccccgag tcgcgccaga tggcgaaggt cacgaagtcc       300
     tcccggtggc tcggcgagaa cttcgagcag gtcccgctgt tcctgttcgc gttcgtccag       360
     cgcgaccgct ccggcggctc gatcttcccg gcggtctgga acgcgcagct ggccgcccgc       420
     gcccaaggcg tcggcagcgc gctgacctcg atcctcggcg gcttccatga ccaagaggtc       480
     aaggagatcc tcggcgtgcc ggccgaggag aagtggaccc agtcctgctg cgtgtccttc       540
     ggctacccga ccggccgctg gggcgtcgcc ccgcgccgtc ccgcgcacga ggtcgcgtac       600
     cggaacggct ggggcgagcc ggtgggcttc accgtcgacg agccgctgtg gcagccctcc       660
     cccgagtcct ga                                                           672
//

If you have problems or comments...

PBIL Back to PBIL home page