(data stored in ACNUC7421 zone)

EMBL: CP001700.PE107

CP001700.PE107       Location/Qualifiers
FT   CDS_pept        complement(110334..110888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sgr:SGR_4289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69062"
FT                   /db_xref="GOA:C7QHC3"
FT                   /db_xref="InterPro:IPR031571"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC3"
FT                   /inference="similar to AA sequence:KEGG:SGR_4289"
FT                   /protein_id="ACU69062.1"
FT                   /translation="MPTATTARPKLAARLSGRRHTSRTRRLRVIGAAGFAGVSMALLTA
FT                   EHSVPPARRPPRFAAESLMSGLVAVPVRFADAGSTGYLRPGDRIDVLAAHDAGPDGPPG
FT                   PPEASSGPIPGLGADPPRGETAVAVDVSVLEIAHSADPGSLTRAAPDDGGLVFLAVDNA
FT                   TAARLARAAVADRLSYALRHG"
     atgcccactg ccaccaccgc ccgcccgaag ctcgccgccc ggctgtccgg ccgccgccac        60
     acctcccgca cccggcggct gcgcgtcatc ggcgccgccg gcttcgccgg ggtctcgatg       120
     gctctgctga ccgcggagca ctccgtcccg ccagcgcgcc gtccgccccg gttcgccgcg       180
     gaatccctga tgagcggcct ggtcgcggtc ccggtgcggt tcgccgacgc cggcagcacc       240
     ggctacctgc gcccgggcga ccggatcgac gtgctggccg cgcacgacgc cggtccggac       300
     gggccgccgg gtccgccgga ggcctcctcc ggcccgatcc ccggcctcgg cgccgacccg       360
     ccacggggtg agaccgcggt cgccgtcgac gtctcagtcc tcgagatcgc gcactccgcg       420
     gaccccggtt cgctcacccg cgccgccccg gacgacggcg gtctggtgtt cctggctgtg       480
     gacaacgcga ccgccgcccg gctggcccgg gccgccgtcg cggaccgcct gagctacgcg       540
     ctgcgccatg gctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page