(data stored in ACNUC7421 zone)

EMBL: CP001700.PE108

CP001700.PE108       Location/Qualifiers
FT   CDS_pept        complement(111026..111454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Caci_0108"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; KEGG:
FT                   sco:SCO3187 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Caci_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACU69063"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:C7QHC4"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ACU69063.1"
FT                   /translation="MPTYQYQCKDCGEALEVVQKFTDDALTVCPNCQGDLRKVFSAVGI
FT                   VFKGSGFYRTDSRSSSSSSTPPGSSSNGSSGSGSGSSSDSGSGSGSGSSGSGSSSGSGG
FT                   SSGSGSSGGSSKGGSSSSSSSTSSSSSSSSGSSSSTKS"
     gtgccgactt accagtacca gtgcaaagac tgcggtgagg cgctggaggt cgtgcagaag        60
     ttcacggacg acgcgctgac cgtgtgcccg aactgccagg gcgacctgcg caaggtcttc       120
     tccgccgtgg gcatcgtgtt caagggcagc ggtttctacc gcaccgacag ccggtcgtcg       180
     tcgagttcgt cgacgccgcc ggggtcgtcc tcgaacggct cgtccgggtc gggttccggt       240
     tcgagttccg actccggctc cggctctggc tctggctctt cggggtcggg gagttcgagc       300
     gggtcgggcg gttccagcgg ctcgggcagc tcaggcggct cctccaaggg cggctcgtcg       360
     tcctcctcgt cgagcacgtc gtcctcgtcc tcgtcaagct cgggctcttc gtcgtccaca       420
     aagagctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page